spacer

EBI Dbfetch

ID   JF272517; SV 1; linear; genomic DNA; STD; HUM; 1289 BP.
XX
AC   JF272517;
XX
DT   09-AUG-2011 (Rel. 109, Created)
DT   04-SEP-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*15;223 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1289
RA   Zhang Y., Zhang X.;
RT   "HLA-B new genotype";
RL   Unpublished.
XX
RN   [2]
RP   1-1289
RA   Zhang Y., Zhang X.;
RT   ;
RL   Submitted (30-JAN-2011) to the INSDC.
RL   HLA LAB, Beijing Daopei Hospital, NO.15 Yuquan Rd.Haidian District,
RL   Beijing, Beijing 100049, China
XX
DR   MD5; 76df423277ac806f0bcb035fb13c07e5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1289
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p"
FT                   /mol_type="genomic DNA"
FT                   /country="China"
FT                   /collection_date="30-Nov-2010"
FT                   /identified_by="Yanling Zhang, Xian Zhang"
FT                   /sex="male"
FT                   /cell_type="blood WBC"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1289
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15;223"
FT   mRNA            join(<1..343,444..719,820..>1289)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15;223"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..343,444..719,820..1289)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15;223"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:G0ZG53"
FT                   /db_xref="IMGT/HLA:B*15:223"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:G0ZG53"
FT                   /protein_id="AEL33688.1"
FT                   /translation="MRVTAPRTVLLLLSGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDRNTQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   gap             344..443
FT                   /estimated_length=unknown
FT   gap             720..819
FT                   /estimated_length=unknown
XX
SQ   Sequence 1289 BP; 223 A; 337 C; 357 G; 172 T; 200 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca ccgccatgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacccagtt cgtgaggttc       180
     gacagcgacg ccgcgagtcc gaggatggcg ccccgggcgc catggataga gcaggagggg       240
     ccggagtatt gggaccggaa cacacagatc tccaagacca acacacagac ttaccgagag       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnggtctca catcatccag aggatgtatg gctgcgacgt       480
     ggggccggac gggcgcctcc tccgcgggca tgaccagtcc gcctacgacg gcaaggatta       540
     catcgccctg aacgaggacc tgagctcctg gaccgcggcg gacacggcgg ctcagatcac       600
     ccagcgcaag tgggaggcgg cccgtgaggc ggagcagctg agagcctacc tggagggcct       660
     gtgcgtggag tggctccgca gatacctgga gaacgggaag gagacgctgc agcgcgcggn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       780
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnna ccccccaaag acacatgtga       840
     cccaccaccc catctctgac catgaggcca ccctgaggtg ctgggccctg ggcttctacc       900
     ctgcggagat cacactgacc tggcagcggg atggcgagga ccaaactcag gacaccgagc       960
     ttgtggagac cagaccagca ggagatagaa ccttccagaa gtgggcagct gtggtggtgc      1020
     cttctggaga agagcagaga tacacatgcc atgtacagca tgaggggctg ccgaagcccc      1080
     tcaccctgag atgggagcca tcttcccagt ccaccatccc catcgtgggc attgttgctg      1140
     gcctggctgt cctagcagtt gtggtcatcg gagctgtggt cgctactgtg atgtgtagga      1200
     ggaagagctc aggtggaaaa ggagggagct actctcaggc tgcgtccagc gacagtgccc      1260
     agggctctga tgtgtctctc acagcttga                                        1289
//


spacer
spacer