spacer

EBI Dbfetch

ID   J03027; SV 1; linear; genomic DNA; STD; HUM; 4361 BP.
XX
AC   J03027;
XX
DT   16-JUL-1988 (Rel. 16, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 14)
XX
DE   Human MHC class I HLA-6.09 gene, complete cds.
XX
KW   cell surface antigen; cell surface glycoprotein; class I gene;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4361
RX   DOI; 10.1073/pnas.84.24.9145.
RX   PUBMED; 3480534.
RA   Geraghty D.E., Koller B.H., Orr H.T.;
RT   "A human major histocompatibility complex class I gene that encodes a
RT   protein with a shortened cytoplasmic segment";
RL   Proc. Natl. Acad. Sci. U.S.A. 84(24):9145-9149(1987).
XX
DR   Ensembl-Gn; ENSG00000204632; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206506; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230413; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233095; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235346; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235680; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237216; homo_sapiens.
DR   Ensembl-Tr; ENST00000360323; homo_sapiens.
DR   Ensembl-Tr; ENST00000376828; homo_sapiens.
DR   Ensembl-Tr; ENST00000383621; homo_sapiens.
DR   Ensembl-Tr; ENST00000400665; homo_sapiens.
DR   Ensembl-Tr; ENST00000400682; homo_sapiens.
DR   Ensembl-Tr; ENST00000420559; homo_sapiens.
DR   Ensembl-Tr; ENST00000422371; homo_sapiens.
DR   Ensembl-Tr; ENST00000423011; homo_sapiens.
DR   Ensembl-Tr; ENST00000423373; homo_sapiens.
DR   Ensembl-Tr; ENST00000428701; homo_sapiens.
DR   Ensembl-Tr; ENST00000428952; homo_sapiens.
DR   Ensembl-Tr; ENST00000434881; homo_sapiens.
DR   Ensembl-Tr; ENST00000444098; homo_sapiens.
DR   Ensembl-Tr; ENST00000449127; homo_sapiens.
DR   Ensembl-Tr; ENST00000450984; homo_sapiens.
DR   Ensembl-Tr; ENST00000546545; homo_sapiens.
DR   Ensembl-Tr; ENST00000546634; homo_sapiens.
DR   Ensembl-Tr; ENST00000547241; homo_sapiens.
DR   Ensembl-Tr; ENST00000547931; homo_sapiens.
DR   Ensembl-Tr; ENST00000550897; homo_sapiens.
DR   Ensembl-Tr; ENST00000553052; homo_sapiens.
DR   EuropePMC; PMC2557436; 12470575.
DR   EuropePMC; PMC331948; 2395643.
DR   EuropePMC; PMC3545901; 23265140.
XX
CC   Draft entry and computer-readable sequence for [1] kindly provided
CC   by H.T.Orr, 22-SEP-1987.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4361
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="HLA6.0."
FT                   /cell_line="721.144"
FT                   /cell_type="lymphoblast"
FT                   /db_xref="taxon:9606"
FT   gene            680..4038
FT                   /gene="MHC HLA-6.09"
FT   exon            680..855
FT                   /gene="MHC HLA-6.09"
FT                   /number=1
FT                   /note="putative"
FT   sig_peptide     783..854
FT                   /gene="MHC HLA-6.09"
FT   prim_transcript <783..>4038
FT                   /gene="MHC HLA-6.09"
FT                   /note="MHC HLA 6.0 mRNA and introns"
FT   CDS             join(783..855,985..1254,1481..1756,2356..2631,2754..2870,
FT                   3314..3318)
FT                   /codon_start=1
FT                   /gene="MHC HLA-6.09"
FT                   /db_xref="GOA:P17693"
FT                   /db_xref="HGNC:HGNC:4964"
FT                   /db_xref="IMGT/HLA:G*01:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1YDP"
FT                   /db_xref="PDB:2D31"
FT                   /db_xref="PDB:2DYP"
FT                   /db_xref="PDB:3BZE"
FT                   /db_xref="PDB:3CDG"
FT                   /db_xref="PDB:3CII"
FT                   /db_xref="PDB:3KYN"
FT                   /db_xref="PDB:3KYO"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17693"
FT                   /protein_id="AAA98745.1"
FT                   /translation="MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPR
FT                   FIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQT
FT                   LRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTA
FT                   AQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYE
FT                   ATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD"
FT   mat_peptide     join(855,985..1254,1481..1756,2356..2631,2754..2870,
FT                   3314..3315)
FT                   /gene="MHC HLA-6.09"
FT   intron          856..984
FT                   /gene="MHC HLA-6.09"
FT                   /number=1
FT   exon            985..1254
FT                   /gene="MHC HLA-6.09"
FT                   /number=2
FT   intron          1255..1480
FT                   /gene="MHC HLA-6.09"
FT                   /number=2
FT   exon            1481..1756
FT                   /gene="MHC HLA-6.09"
FT                   /number=3
FT   intron          1757..2355
FT                   /gene="MHC HLA-6.09"
FT                   /number=3
FT   exon            2356..2631
FT                   /gene="MHC HLA-6.09"
FT                   /number=4
FT   intron          2632..2753
FT                   /gene="MHC HLA-6.09"
FT                   /number=4
FT   exon            2754..2870
FT                   /gene="MHC HLA-6.09"
FT                   /number=5
FT   intron          2871..3313
FT                   /gene="MHC HLA-6.09"
FT                   /number=5
FT   exon            3314..3346
FT                   /gene="MHC HLA-6.09"
FT                   /number=6
FT   intron          3347..3487
FT                   /gene="MHC HLA-6.09"
FT                   /number=6
FT   exon            3488..3535
FT                   /gene="MHC HLA-6.09"
FT                   /number=7
FT   intron          3536..3702
FT                   /gene="MHC HLA-6.09"
FT                   /number=7
FT   exon            3703..>4038
FT                   /gene="MHC HLA-6.09"
FT                   /number=8
FT   polyA_signal    4033..4038
FT                   /gene="MHC HLA-6.09"
XX
SQ   Sequence 4361 BP; 915 A; 1191 C; 1264 G; 991 T; 0 other;
     caagcgggag tcacagatac actgtctggg aaagtgaaac ttaagagctt tgtgagtcct        60
     gttgtaatgc ttttagatgc atttatatac caacaggcca aagtcacatt ttttaccgat       120
     tagattcctg atcattcagg ggttaccaag gttatgctac ccactatagt taataaacaa       180
     aaagcaaact ggtctctatt ctatctcatg cactcaggca caacttttcc agatttaagg       240
     gggaaaaaaa accctgtctt tacacctaca atcccagggc gagctcactc tctggcaaca       300
     agctccctgg ggtgattttt cttctagaag agtacaggag gacaggcaag gagtgggagg       360
     cagggagtcc agttcaggga cagggattcc gggatgaaaa gtgaagggag agggccaggg       420
     accttgccga gggtttctcc ctggtttctc agacagctcc tgggccaaga ctcagggaga       480
     cactgagaca gaacgcttgg cacaagagta gcggggtcag ggcgaagtcc cagggcctca       540
     agcgtggctc tcagggtctc aggccccaca ggcggtgtat gggttgggga ggccccgcgt       600
     tggggattct ctcctccttc tcctaacctg tgtcgggtcc ttcttcctgg atactcaccg       660
     ggcggcccca gttctcactc ccattaggtg acaggttttt agagaagcca atcacgtcgc       720
     cgcggtcctg gttctaaagt cctcgctcac ccacccggac tcattctccc cagacgccaa       780
     ggatggtggt catggcgccc cgaaccctct tcctgctgct ctcgggggcc ctgaccctga       840
     ccgagacctg ggcgggtgag tgcggggtca ggagggaaac ggcccctgcg cggaggaggg       900
     aggggcccgc ctggcggggg cgcaggactc ggcagccgcg ccgggaggag ggtcgggcgg       960
     gtctcaaccc ctcctcgccc ccaggctccc actccatgag gtatttcagc gccgccgtgt      1020
     cccggcccgg ccgcggggag ccccgcttca tcgccatggg ctacgtggac gacacgcagt      1080
     tcgtgcggtt cgacagcgac tcggcgtgtc cgaggatgga gccgcgggcg ccgtgggtgg      1140
     agcaggaggg gccggagtat tgggaagagg agacacggaa caccaaggcc cacgcacaga      1200
     ctgacagaat gaacctgcag accctgcgcg gctactacaa ccagagcgag gccagtgagt      1260
     aactccggcc cagggagcag atcacgaccc ccacctccat gccccacgga cggcccgggt      1320
     actcccgagt ctccgggtct gggatccacc ccgaggccgc gggacccgcc cagaccctct      1380
     acctgggaga accccaaggc gcctttacca aaatccccgc gggtgggtcc gggcgagggc      1440
     gaggctcggt gggcggggct gaccgagggg gtggggccag gttctcacac cctccagtgg      1500
     atgattggct gcgacctggg gtccgacgga cgcctcctcc gcgggtatga acagtatgcc      1560
     tacgatggca aggattacct cgccctgaac gaggacctgc gctcctggac cgcagcggac      1620
     actgcggctc agatctccaa gcgcaagtgt gaggcggcca atgtggctga acaaaggaga      1680
     gcctacctgg agggcacgtg cgtggagtgg ctccacagat acctggagaa cgggaaggag      1740
     atgctgcagc gcgcgggtac caggggcagt ggggcgcctc cctgatctcc tgtagacctc      1800
     tcagcctggc ctagcacaag gagaggagga aaatgggacc aacactagaa tatcgccctc      1860
     cctctggtcc tgagggagag gaatcctcct gggtttccag atcctgtacc agagagtgat      1920
     tctgagggcc cgtcctgctc tctgggacaa ttaagggatg aagtctctga gggagtggag      1980
     gggaagacaa tccctggaag actgatcagg ggttcccttt gaccccacag cagccttggc      2040
     accaggactt ttcccctcag gccttgttct ctgcctcaca ctcaatgtgt gtgggggtct      2100
     gactccagct cctctgagtc ccttggcctc cactcaggtc agaaccggag gtccctgctc      2160
     ccccgctcag agactagaac tttccaagga ataggagatt atcccaggtg cccgtgtcca      2220
     ggctggtgtc tgggttctgt gctcccttcc ccaccccagg tatctggttc attcttagga      2280
     tggtcacatc caggtgctgc tggagtgtcc catgagagat gcaaagtgct tgaattttct      2340
     gactcttcct ttcagacccc cccaagacac acgtgaccca ccaccctgtc tttgactatg      2400
     aggccaccct gaggtgctgg gccctgggct tctaccctgc ggagatcata ctgacctggc      2460
     agcgggatgg ggaggaccag acccaggacg tggagctcgt ggagaccagg cctgcagggg      2520
     atggaacctt ccagaagtgg gcagctgtgg tggtgccttc tggagaggag cagagataca      2580
     cgtgccatgt gcagcatgag gggctgccgg agcccctcat gctgagatgg agtaaggagg      2640
     gagatggagg catcatgtct gttagggaaa gcaggagcct ctctgaagac ctttaacagg      2700
     gtcggtggtg agggctgggg gtcagagacc ctcaccttca cctcctttcc cagagcagtc      2760
     ttccctgccc accatcccca tcatgggtat cgttgctggc ctggttgtcc ttgcagctgt      2820
     agtcactgga gctgcggtcg ctgctgtgct gtggagaaag aagagctcag gtaaggaagg      2880
     ggtgacaagt ggggtctgag ttttcttgtc ccactggggg tttcaagccc caggtagaag      2940
     tgtgccctgc ctggttactg ggaagcacca tccacactca tgggcctacc cagcctgggc      3000
     cctgtgtgcc agcaccttct cttttgtaaa gcacctgtga caatgaagga cagatttatt      3060
     accttgatga ttgtagtgat ggggacctga tcccagtaat cacaggtcag gagaaggtcc      3120
     ctggctaagg acagacctta ggagggcagt tggtcgagga cccacatctg ctttccttgt      3180
     ttttcctgat cgccctgggt ctgcagtcac acatttctgg aaacttctcg agggtccaag      3240
     actaggaggt tcctctagga cctcatggcc ctgccacctt tctggcctct cacaggacat      3300
     tttcttccca cagattgaaa aggagggagc tactctcagg ctgcaagtaa gtatgaagga      3360
     ggctgatccc tgagatcctt gggatcttgt gtttgggagc catgggggag ctcacccacc      3420
     ccacaattcc tcctctggcc acatctcctg tggtctctga ccaggtgctg tttttgttct      3480
     actctaggca gtgacagtgc ccagggctct aatgtgtctc tcacggcttg taaatgtgac      3540
     accccggggg gcctgatgtg tgtgggttgt tgaggggaac aggggacata gctgtgctat      3600
     gaggtttctt tgacttcaat gtattgagca tgtgatgggc tgtttaaagt gtcacccctc      3660
     actgtgactg atatgaattt gttcatgaat atttttctgt agtgtgaaac agctgccctg      3720
     tgtgggactg agtggcaagt ccctttgtga cttcaagaac cctgacttct ctttgtgcag      3780
     agaccagccc acccctgtgc ccaccatgac cctcttcctc atgctgaact gcattccttc      3840
     cccaatcacc tttcctgttc cagaaaaggg gctgggatgt ctccgtctct gtctcaaatt      3900
     tgtggtccac tgagctataa cttacttctg tattaaaatt agaatctgag tgtaaattta      3960
     ctttttcaaa ttatttccaa gagagattga tgggttaatt aaaggagaag attcctgaaa      4020
     tttgagagac aaaataaatg gaagacatga gaactttcca cagtacacgt gtttcttgtg      4080
     ctgatttgtt gcaggagagg agagtagatg gggctgccca gtgggtgctc aggccaccat      4140
     gaactttatg tggtcactgc tcagctgggt catctttgct gctccattgt ccttggccct      4200
     tcagtagaac cttgtcccac caggacctgt gatcacatag acttggatat cacctagggt      4260
     ggtccctaca cgtagaagtt cctgtgttat cagaagaaaa attttcagac ccctacacct      4320
     cttcccctcc ttccaggtct ctttcaattg tattttccat c                          4361
//


spacer
spacer