spacer

EBI Dbfetch

ID   J00201; SV 1; linear; genomic DNA; STD; HUM; 1806 BP.
XX
AC   J00201;
XX
DT   13-JUN-1985 (Rel. 06, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   human hla-dr antigen heavy chain gene encoding aa3-229.
XX
KW   antigen; histocompatibility antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1806
RX   DOI; 10.1073/pnas.79.19.6013.
RX   PUBMED; 6821129.
RA   Korman A.J., Auffray C., Schamboeck A., Strominger J.L.;
RT   "The amino acid sequence and gene organization of the heavy chain of the
RT   HLA-DR antigen: homology to immunoglobulins";
RL   Proc. Natl. Acad. Sci. U.S.A. 79(19):6013-6017(1982).
XX
DR   MD5; 2d254ac60d66cdc51329c89be20ce589.
DR   Ensembl-Gn; ENSG00000204287; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206308; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226260; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227993; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228987; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230726; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234794; homo_sapiens.
DR   Ensembl-Tr; ENST00000383127; homo_sapiens.
DR   Ensembl-Tr; ENST00000383259; homo_sapiens.
DR   Ensembl-Tr; ENST00000395388; homo_sapiens.
DR   Ensembl-Tr; ENST00000411524; homo_sapiens.
DR   Ensembl-Tr; ENST00000414698; homo_sapiens.
DR   Ensembl-Tr; ENST00000416883; homo_sapiens.
DR   Ensembl-Tr; ENST00000442960; homo_sapiens.
XX
CC   exon1 lacks the codons for amino acids 1 and 2, and only has bases
CC   2 and 3 of codon 3. see  for missing codons. exon2 shows
CC   strong homology with ig constant regions and ig-like domains in
CC   hla-b7, beta2-microglobulin and hla-dr light chain. 58% homology
CC   between dr-h and dr-l in the first cys block and 56% homology in
CC   the second cys block, and 56% homology between dr-h and hla-b7 in
CC   the second cys block. exon3 encodes the connection, transmembrane
CC   and intracytoplasmic peptides and has a portion of the 3' mrna
CC   flank. see  for exon4 (mrna completion).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1806
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<64..303,794..1075,1365..1519)
FT                   /codon_start=3
FT                   /note="hla-dr antigen heavy chain (aa 3 at 60)"
FT                   /db_xref="GOA:P01903"
FT                   /db_xref="HGNC:HGNC:4947"
FT                   /db_xref="IMGT/HLA:DRA*01:02:01"
FT                   /db_xref="InterPro:IPR001003"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1A6A"
FT                   /db_xref="PDB:1AQD"
FT                   /db_xref="PDB:1BX2"
FT                   /db_xref="PDB:1D5M"
FT                   /db_xref="PDB:1D5X"
FT                   /db_xref="PDB:1D5Z"
FT                   /db_xref="PDB:1D6E"
FT                   /db_xref="PDB:1DLH"
FT                   /db_xref="PDB:1FV1"
FT                   /db_xref="PDB:1FYT"
FT                   /db_xref="PDB:1H15"
FT                   /db_xref="PDB:1HQR"
FT                   /db_xref="PDB:1HXY"
FT                   /db_xref="PDB:1J8H"
FT                   /db_xref="PDB:1JWM"
FT                   /db_xref="PDB:1JWS"
FT                   /db_xref="PDB:1JWU"
FT                   /db_xref="PDB:1KG0"
FT                   /db_xref="PDB:1KLG"
FT                   /db_xref="PDB:1KLU"
FT                   /db_xref="PDB:1LO5"
FT                   /db_xref="PDB:1PYW"
FT                   /db_xref="PDB:1R5I"
FT                   /db_xref="PDB:1SEB"
FT                   /db_xref="PDB:1SJE"
FT                   /db_xref="PDB:1SJH"
FT                   /db_xref="PDB:1T5W"
FT                   /db_xref="PDB:1T5X"
FT                   /db_xref="PDB:1YMM"
FT                   /db_xref="PDB:1ZGL"
FT                   /db_xref="PDB:2FSE"
FT                   /db_xref="PDB:2G9H"
FT                   /db_xref="PDB:2IAM"
FT                   /db_xref="PDB:2IAN"
FT                   /db_xref="PDB:2ICW"
FT                   /db_xref="PDB:2IPK"
FT                   /db_xref="PDB:2OJE"
FT                   /db_xref="PDB:2Q6W"
FT                   /db_xref="PDB:2SEB"
FT                   /db_xref="PDB:2WBJ"
FT                   /db_xref="PDB:2XN9"
FT                   /db_xref="PDB:3C5J"
FT                   /db_xref="PDB:3L6F"
FT                   /db_xref="PDB:3O6F"
FT                   /db_xref="PDB:3PDO"
FT                   /db_xref="PDB:3PGC"
FT                   /db_xref="PDB:3PGD"
FT                   /db_xref="PDB:3QXA"
FT                   /db_xref="PDB:3QXD"
FT                   /db_xref="PDB:3S4S"
FT                   /db_xref="PDB:3S5L"
FT                   /db_xref="PDB:3T0E"
FT                   /db_xref="PDB:4AEN"
FT                   /db_xref="PDB:4AH2"
FT                   /db_xref="PDB:4C56"
FT                   /db_xref="PDB:4E41"
FT                   /db_xref="PDB:4FQX"
FT                   /db_xref="PDB:4GBX"
FT                   /db_xref="PDB:4H1L"
FT                   /db_xref="PDB:4H25"
FT                   /db_xref="PDB:4H26"
FT                   /db_xref="PDB:4I5B"
FT                   /db_xref="PDB:4IS6"
FT                   /db_xref="PDB:4MCY"
FT                   /db_xref="PDB:4MCZ"
FT                   /db_xref="PDB:4MD0"
FT                   /db_xref="PDB:4MD4"
FT                   /db_xref="PDB:4MD5"
FT                   /db_xref="PDB:4MDI"
FT                   /db_xref="PDB:4MDJ"
FT                   /db_xref="PDB:4OV5"
FT                   /protein_id="AAA36301.1"
FT                   /translation="VIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGR
FT                   FASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREPNVLICFI
FT                   DKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLPSTEDVYDCRVEHW
FT                   GLDEPLLKHWEFDAPSPLPETTENVVCALGLTVGLVGIIIGTIFIIKGLRKSNAAERRG
FT                   PL"
FT   exon            <64..303
FT                   /note="hla-dr antigen heavy chain"
FT   exon            <794..1075
FT                   /note="hla-dr antigen heavy chain"
FT   exon            1365..>1519
FT                   /note="hla-dr antigen heavy chain"
XX
SQ   Sequence 1806 BP; 436 A; 440 C; 401 G; 529 T; 0 other;
     attcccctct cttgattccc cccgcccaac tctctttctc catttcttgc ctttcagaag        60
     aacatgtgat catccaggcc gagttctatc tgaatcctga ccaatcaggc gagtttatgt       120
     ttgactttga tggtgatgag attttccatg tggatatggc aaagaaggag acggtctggc       180
     ggcttgaaga atttggacga tttgccagct ttgaggctca aggtgcattg gccaacatag       240
     ctgtggacaa agccaacctg gaaatcatga caaagcgctc caactatact ccgatcacca       300
     atggtacctc cctctctgct gcactcctgg acacgggaat ccatagtttg aaagtagttg       360
     cttcagctct ttgtgttaga ttattgtaac tgattttccc tccaagggcc taaccttgcc       420
     attaacaagc cccaaattct catgccagag gtctgagaac tttatgggtt tgatcctatc       480
     ttgttgtgct caagtcttgt ctctgtcatc catggtctcc tacgaagtca ttgccctaag       540
     ttcatgctag gggagccaga agggaagtcc ttggatatct tatacctcaa tattggctca       600
     atctcttggg gagggggtgc tgtcagagac tgttatctga ggatgtgaca tagacttctc       660
     agggcacaat ttcaactact ttttcagctt tagggttttt agatacgttt gtaccacaat       720
     tgagcatggg agggagaggg gtgagcctaa gcagtgacgg ctgattctgt cacgtctgtc       780
     atgtgtcccc cagtacctcc agaggtaact gtgctcacga acagccctgt ggaactgaga       840
     gagcccaacg tcctcatctg tttcatcgac aagttcaccc caccagtggt caatgtcacg       900
     tggcttcgaa atggaaaacc tgtcaccaca ggagtgtcag agacagtctt cctgcccagg       960
     gaagaccacc ttttccgcaa gttccactat ctccccttcc tgccctcaac tgaggacgtt      1020
     tacgactgca gggtggagca ctggggcttg gatgagcctc ttctcaagca ctggggtatg      1080
     gaccaacact caatctcctt tatttcaagg tttcctccta tgatgcttgt gtgaaactcg      1140
     gtgttctaac tgtttcataa tatctgctac aattaatata actgtcttct cctactatcc      1200
     agcttcctcc tttttttaat ctgtaattct ctcaatacat cattctgtct tcctcttctt      1260
     taatctatga ataacttttc tctttctaaa gaaccctaca tttgattctg agtgttactt      1320
     cttcccacac tcattaccat gtactctgcc ttatctcccc ccagagtttg atgctccaag      1380
     ccctctccca gagactacag agaacgtggt gtgtgccttg ggcctgactg tgggtctggt      1440
     gggcatcatt attgggacca tcttcatcat caagggattg cgcaaaagca atgcagcaga      1500
     acgcaggggg cctctgtaag gcacatggag gtgagttagg tgtggtcaga ggaagacata      1560
     tatggagata tctgagggag gaaaatcagg gtggggaaag gaaatgtaat gcatttaaga      1620
     gacaaggtag gaacagatgt ggctcttgat ttctctttgc tagaatgaat cagacattgg      1680
     tatcatctgg taccccaaag cttccgggtc tgtcatccct ttctatagac gggcaccttg      1740
     atcacggctc cagtcttaga aatcatctcc agtacctaaa accattgttt cacattagaa      1800
     tactga                                                                 1806
//


spacer
spacer