spacer

EBI Dbfetch

ID   HQ896940; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   HQ896940;
XX
DT   31-JUL-2011 (Rel. 109, Created)
DT   31-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*09 variant
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Li J.-P., Zhang X.;
RT   "Identification of a new HLA-DRB1*09 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Li J.-P., Zhang X.;
RT   ;
RL   Submitted (19-JAN-2011) to the INSDC.
RL   HLA Lab, Liaoning Blood Center, Beihai Street Dadong District, Shenyang,
RL   Liaoning 110044, China
XX
DR   MD5; e3d50863b714004865e398b29f3f7a59.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*09 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*09 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*09 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:G0Z6Y8"
FT                   /db_xref="IMGT/HLA:DRB1*09:12"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:G0Z6Y8"
FT                   /protein_id="AEK86204.1"
FT                   /translation="RFLKQDNFECHFFNGTERVRYLHRGIYNQEENVRFDSDVGEYRAV
FT                   TELGRPVAESWNSQKDFLERRRAEVDTVCRHNYGVGESFTVQRR"
XX
SQ   Sequence 270 BP; 60 A; 62 C; 101 G; 47 T; 0 other;
     cacgtttctt gaagcaggat aactttgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggtatctgca cagaggcatc tataaccaag aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacttcct ggagcggagg cgggccgagg tggacaccgt gtgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagaggcgag                                        270
//


spacer
spacer