spacer

EBI Dbfetch

ID   HQ896938; SV 1; linear; genomic DNA; STD; HUM; 1861 BP.
XX
AC   HQ896938;
XX
DT   31-JUL-2011 (Rel. 109, Created)
DT   31-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*11 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1861
RA   Li J.-P.;
RT   "Identification of a new HLA-A*11 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-1861
RA   Li J.-P.;
RT   ;
RL   Submitted (19-JAN-2011) to the INSDC.
RL   HLA Lab, Liaoning Blood Center, Beihai Street Dadong District, Shenyang,
RL   Liaoning 110044, China
XX
DR   MD5; 250a97541cb5fae68d2e46b9cbeac23f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1861
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1861
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11 variant"
FT   mRNA            join(<1..270,512..787,1367..1642,1745..>1861)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..787,1367..1642,1745..>1861)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:G0Z6Y6"
FT                   /db_xref="IMGT/HLA:A*11:101"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:G0Z6Y6"
FT                   /protein_id="AEK86202.1"
FT                   /translation="SHSMRYFYTSVSRPGRGKPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEDGSHTIRIMYGCDVGP
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHAAEQQRAYLEGRC
FT                   VEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTI
FT                   PIVGIIAGLVLLGAVITGAVVAAVMWRRKSS"
FT   gap             271..511
FT                   /estimated_length=241
FT   gap             788..1366
FT                   /estimated_length=579
FT   gap             1643..1744
FT                   /estimated_length=102
XX
SQ   Sequence 1861 BP; 187 A; 284 C; 323 G; 145 T; 922 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc gggaagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ngttctcaca ccatccggat aatgtatggc       540
     tgcgacgtgg ggccggacgg gcgcttcctc cgcgggtacc ggcaggacgc ctacgacggc       600
     aaggattaca tcgccctgaa cgaggacctg cgctcttgga ccgcggcgga catggcagct       660
     cagatcacca agcgcaagtg ggaggcggcc catgcggcgg agcagcagag agcctacctg       720
     gagggccggt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacggnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnaccc ccccaagaca      1380
     catatgaccc accaccccat ctctgaccat gaggccaccc tgaggtgctg ggccctgggc      1440
     ttctaccctg cggagatcac actgacctgg cagcgggatg gggaggacca gacccaggac      1500
     acggagctcg tggagaccag gcctgcaggg gatggaacct tccagaagtg ggcggctgtg      1560
     gtggtgcctt ctggagagga gcagagatac acctgccatg tgcagcatga gggtctgccc      1620
     aagcccctca ccctgagatg ggnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1680
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1740
     nnnnagctgt cttcccagcc caccatcccc atcgtgggca tcattgctgg cctggttctc      1800
     cttggagctg tgatcactgg agctgtggtc gctgccgtga tgtggaggag gaagagctca      1860
     g                                                                      1861
//


spacer
spacer