Dbfetch

ID   HQ896937; SV 1; linear; genomic DNA; STD; HUM; 1642 BP.
XX
AC   HQ896937;
XX
DT   31-JUL-2011 (Rel. 109, Created)
DT   31-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*55 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1642
RA   Li J.-P., Zhang X.;
RT   "Identification of a new HLA-B*55 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-1642
RA   Li J.-P., Zhang X.;
RT   ;
RL   Submitted (19-JAN-2011) to the INSDC.
RL   HLA Lab, Liaoning Blood Center, Beihai Street Dadong District, Shenyang,
RL   Liaoning 110044, China
XX
DR   MD5; be75d699bd1d23f8e3d9ad633c67a3bd.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1642
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1642
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55 variant"
FT   mRNA            join(<1..270,516..791,1367..>1642)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,516..791,1367..>1642)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*55:50"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:G0Z6Y5"
FT                   /protein_id="AEK86201.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTWQTMYGCDLGP
FT                   DGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTAAQITQLKWEAARVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   gap             271..515
FT                   /estimated_length=245
FT   gap             792..1366
FT                   /estimated_length=575
XX
SQ   Sequence 1642 BP; 180 A; 252 C; 276 G; 114 T; 820 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnggtct cacacttggc agacgatgta       540
     tggctgcgac ctggggccgg acgggcgcct cctccgcggg cataaccagt tagcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgagctcc tggaccgcgg cggacaccgc       660
     ggctcagatc acccagctca agtgggaggc ggcccgtgtg gcggagcagc tgagagccta       720
     cctggagggc acgtgcgtgg agtggctccg cagatacctg gagaacggga aggagacgct       780
     gcagcgcgcg gnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnaccc cccaaagaca      1380
     cacgtgaccc accaccccat ctctgaccat gaggccaccc tgaggtgctg ggccctgggc      1440
     ttctaccctg cggagatcac actgacctgg cagcgggatg gcgaggacca aactcaggac      1500
     actgagcttg tggagaccag accagcagga gatagaacct tccagaagtg ggcagctgtg      1560
     gtggtgcctt ctggagaaga gcagagatac acatgccatg tacagcatga ggggctgccg      1620
     aagcccctca ccctgagatg gg                                               1642
//