spacer

EBI Dbfetch

ID   HQ733858; SV 1; linear; genomic DNA; STD; HUM; 273 BP.
XX
AC   HQ733858;
XX
DT   03-JUL-2011 (Rel. 109, Created)
DT   03-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*3501 allele, exon 4
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-273
RA   Lin Q.F., Jiao L.X., Yang F., Han Y., Yu J.H., Ju R.Q.;
RT   "A HLA-B*3501 variant sequence";
RL   Unpublished.
XX
RN   [2]
RP   1-273
RA   Lin Q.F., Jiao L.X., Yang F., Han Y., Yu J.H., Ju R.Q.;
RT   ;
RL   Submitted (14-DEC-2010) to the INSDC.
RL   HLA Labratory, JiLin Province Blood Center, 5916 Ziyou Road, Changchun,
RL   JiLin 130031, China
XX
DR   MD5; b4e9ac9ac9b3f92d08f7f5835a391fe1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..273
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>273
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3501"
FT   mRNA            <1..>273
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3501"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>273
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3501"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*35:161"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:F8T958"
FT                   /protein_id="AEI98732.1"
FT                   /translation="PPKTHVTHHPVSDHEATMRCWALGFYPAEITLTWQRDGEDQTQDT
FT                   ELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            <1..>273
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3501"
FT                   /number=4
XX
SQ   Sequence 273 BP; 67 A; 82 C; 82 G; 42 T; 0 other;
     cccccaaaga cacacgtgac ccaccacccc gtctctgacc atgaggccac catgaggtgc        60
     tgggccctgg gcttctaccc tgcggagatc acactgacct ggcagcggga tggcgaggac       120
     caaactcagg acactgagct tgtggagacc agaccagcag gagatagaac cttccagaag       180
     tgggcagctg tggtggtgcc ttctggagaa gagcagagat acacatgcca tgtacagcat       240
     gaggggctgc cgaagcccct caccctgaga tgg                                    273
//


spacer
spacer