Dbfetch

ID   HQ696460; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   HQ696460;
XX
DT   21-JUN-2011 (Rel. 109, Created)
DT   21-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens isolate 5361000082 MHC class I antigen (HLA-A) gene, exons 2,
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Jiao S.-X., Feng Z.-H., Hu B., Chi X.-Y., Li C.-Y., Du Z.-H., Sun X.-M.,
RA   Zhao L.;
RT   "A novel HLA-A allele identified by sequence based typing in a Chinese bone
RT   marrow donor";
RL   Unpublished.
XX
RN   [2]
RP   1-646
RA   Jiao S.-X., Feng Z.-H., Hu B., Chi X.-Y., Li C.-Y., Du Z.-H., Sun X.-M.,
RA   Zhao L.;
RT   ;
RL   Submitted (03-DEC-2010) to the INSDC.
RL   Qingdao HLA Typing Lab, Qingdao Blood Center, 9 Longde Road, Qingdao,
RL   Shandong 266071, P.R. China
XX
DR   MD5; aed6d1ca384a8e90fe838dd6df7ee6a5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /isolate="5361000082"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-A"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:A*11:97"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:F8SWL5"
FT                   /protein_id="AEI17784.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDALSQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEDGSHTIQIMYGCDVGP
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHAAEQQRAYLEGRC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            <1..270
FT                   /gene="HLA-A"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..>646
FT                   /gene="HLA-A"
FT                   /number=3
XX
SQ   Sequence 646 BP; 110 A; 163 C; 197 G; 76 T; 100 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgcct       120
     tgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac catccagata atgtatggct gcgacgtggg gccggacggg       420
     cgcttcctcc gcgggtaccg gcaggacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcttggac cgcggcggac atggcagctc agatcaccaa gcgcaagtgg       540
     gaggcggccc atgcggcgga gcagcagaga gcctacctgg agggccggtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacgg                      646
//