spacer

EBI Dbfetch

ID   HQ693697; SV 1; linear; genomic DNA; STD; HUM; 3391 BP.
XX
AC   HQ693697;
XX
DT   31-MAY-2011 (Rel. 109, Created)
DT   31-MAY-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*44new allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3391
RA   Serov Y.A., Hommel-Berrey G.A., House K.D., Arnoff T.S., Lobashevsky A.L.;
RT   "New B*44:02 Allele Variant";
RL   Unpublished.
XX
RN   [2]
RC   Nucleotide Change (IMGT/HLA:606 178c Exon 3)  HLA B*44:02:01:01:ACG->ACC
RC   Thr (Silent change)
RP   1-3391
RA   Serov Y.A., Hommel-Berrey G.A., House K.D., Arnoff T.S., Lobashevsky A.L.;
RT   ;
RL   Submitted (11-NOV-2010) to the INSDC.
RL   Medicine, Indiana University (IUPUI), Riley Hospital, Room 0615, 702
RL   Barnhill Drive, Indianapolis, IN 46202, USA
XX
DR   MD5; a4a2175e1b4f2d8ca9b4907178e10790.
DR   Ensembl-Gn; ENSG00000228964; homo_sapiens.
DR   Ensembl-Tr; ENST00000421349; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3391
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..3391
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT   mRNA            join(<1..393,523..792,1036..1311,1887..2162,2256..2372,
FT                   2814..2846,2953..3391)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /product="MHC class I antigen"
FT   exon            <1..393
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=1
FT   5'UTR           <1..320
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT   CDS             join(321..393,523..792,1036..1311,1887..2162,2256..2372,
FT                   2814..2846,2953..2996)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D5H3J5"
FT                   /db_xref="IMGT/HLA:B*44:02:17"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D5H3J5"
FT                   /protein_id="AEF97826.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRT
FT                   ALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   VTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   exon            523..792
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=2
FT   exon            1036..1311
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=3
FT   variation       1298
FT                   /gene="HLA-B"
FT                   /replace="g"
FT                   /note="synonymous substitution"
FT   exon            1887..2162
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=4
FT   exon            2256..2372
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=5
FT   exon            2814..2846
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=6
FT   exon            2953..3391
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=7
FT   3'UTR           2997..3391
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
XX
SQ   Sequence 3391 BP; 631 A; 983 C; 1073 G; 704 T; 0 other;
     gacagtgtga caaagaggcc ggtgtaggag aagagggatc aggacgaagt cccaggtccc        60
     ggacggggct ctcagggtct caggctccga gggccgcgtc tgcaatgggg aggcgcagcg       120
     ttggggattc cccactccca cgagtttcac ttcttctccc aacctatgtc gggtccttct       180
     tccaggatac tcgtgacgcg tccccatttc ccactcccat tgggtgtcgg gtgtctagag       240
     aagccaatca gtgtcgccgg ggtcccagtt ctaaagtccc cacgcaccca cccggactca       300
     gaatctcctc agacgccgag atgcgggtca cggcgccccg aaccctcctc ctgctgctct       360
     ggggggcagt ggccctgacc gagacctggg ccggtgagtg cggggtcggg agggaaatgg       420
     cctctgtggg gaggagagag gggaccgcag gcgggggcgc aggacccggg gagccgcgcc       480
     gggaggaggg tcgggcgggt ctcagcccct cctcgccccc aggctcccac tccatgaggt       540
     atttctacac cgccatgtcc cggcccggcc gcggggagcc ccgcttcatc accgtgggct       600
     acgtggacga cacgctgttc gtgaggttcg acagcgacgc cacgagtccg aggaaggagc       660
     cgcgggcgcc atggatagag caggaggggc cggagtattg ggaccgggag acacagatct       720
     ccaagaccaa cacacagact taccgagaga acctgcgcac cgcgctccgc tactacaacc       780
     agagcgaggc cggtgagtga ccccggcccg gggcgcaggt cacgactccc catcccccac       840
     gtacggcccg ggtcgccccg agtctccggg tccgagatcc gcccccgagg ccgcgggacc       900
     cgcccagacc ctcgaccggc gagagcccca ggcgcgttta cccggtttca ttttcagttg       960
     aggccaaaat ccccgcgggt tggtcggggc ggggcggggc tcgggggacg gggctgaccg      1020
     cggggccggg gccagggtct cacatcatcc agaggatgta cggctgcgac gtggggccgg      1080
     acgggcgcct cctccgcggg tatgaccagg acgcctacga cggcaaggat tacatcgccc      1140
     tgaacgagga cctgagctcc tggaccgcgg cggacaccgc ggctcagatc acccagcgca      1200
     agtgggaggc ggcccgtgtg gcggagcagg acagagccta cctggagggc ctgtgcgtgg      1260
     agtcgctccg cagatacctg gagaacggga aggagaccct gcagcgcgcg ggtaccaggg      1320
     gcagtgggga gccttcccca tctcctatag gtcgccgggg atggcctccc acgagaagag      1380
     gaggaaaatg ggatcagcgc tagaatgtcg ccctcccttg aatggagaat ggcatgagtt      1440
     ttcctgagtt tcctctgagg gccccctctt ctctctagga caattaaggg atgacgtctc      1500
     tgaggaaatg gaggggaaga cagtccctag aatactgatc aggggtcccc tttgacccct      1560
     gcagcagcct tgggaaccgt gacttttcct ctcaggcctt gttctctgcc tcacactcag      1620
     tgtgtttggg gctctgattc cagcacttct gagtcacttt acctccactc agatcaggag      1680
     cagaagtccc tgttccccgc tcagagactc gaactttcca atgaatagga gattatccca      1740
     ggtgcctgcg tccaggctgg tgtctgggtt ctgtgcccct tccccacccc aggtgtcctg      1800
     tccattctca ggctggtcac atgggtggtc ctagggtgtc ccatgagaga tgcaaagcgc      1860
     ctgaattttc tgactcttcc catcagaccc cccaaagaca catgtgaccc accaccccat      1920
     ctctgaccat gaggtcaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac      1980
     actgacctgg cagcgggatg gcgaggacca aactcaggac accgagcttg tggagaccag      2040
     accagcagga gatagaacct tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga      2100
     gcagagatac acatgccatg tacagcatga ggggctgccg aagcccctca ccctgagatg      2160
     gggtaaggag ggggatgagg ggtcatatct cttctcaggg aaagcaggag cccttcagca      2220
     gggtcagggc ccctcatctt cccttccttt cccagagccg tcttcccagt ccaccgtccc      2280
     catcgtgggc attgttgctg gcctggctgt cctagcagtt gtggtcatcg gagctgtggt      2340
     cgctgctgtg atgtgtagga ggaagagctc aggtagggaa ggggtgaggg gtggggtctg      2400
     ggttttcttg tcccactggg ggtttcaagc cccaggtaga agtgttccct gcctcattac      2460
     tgggaagcag catccacaca ggggctaacg cagcctggga ccctgtgtgc cagcacttac      2520
     tcttttgtgc agcacatgtg acaatgaagg acggatgtat caccttggtg gttgtggtgt      2580
     tggggtcctg attccagcat tcatgagtca ggggaaggtc cctgctaagg acagacctta      2640
     ggagggcagt tggtccagga cccacacttg ctttcctcgt gtttcctgat cctgccttgg      2700
     gtctgtagtc atacttctgg aaattccttt tgggtccaag acgaggaggt tcctctaaga      2760
     tctcatggcc ctgcttcctc ccagtcccct cacagggcat tttcttccca caggtggaaa      2820
     aggagggagc tactctcagg ctgcgtgtaa gtgatggggg cgggagtgtg gaggagctca      2880
     cccaccccat aattcctcct gtcccacgtc tcctgcgggc tctgaccagg tcctgttttt      2940
     gttctactcc aggcagcgac agtgcccagg gctctgatgt gtctctcaca gcttgaaaag      3000
     gtgagattct tggggtctag agtgggtggg gtggcaggtc tgggggtggg tggggcagtg      3060
     gggaaaggcc tgggtaatgg agattctttg attgggatgt ttcgcgtgtg tggtgggctg      3120
     tttagagtgt catcacttac catgactaac cagaatttgt tcatgactgt tgttttctgt      3180
     agcctgagac agctgtcttg tgagggactg agatgcagga tttcttcacg cctccccttt      3240
     gtgacttcaa gagcctctgg catctctttc tgcaaaggca cctgaatgtg tctgcgtccc      3300
     tgttagcata atgtgaggag gtggagagac agcccacccc cgtgtccacc gtgacccctg      3360
     ttcccatgct gacctgtgtt tcctccccag a                                     3391
//


spacer
spacer