Dbfetch

ID   HQ692872; SV 1; linear; genomic DNA; STD; HUM; 1195 BP.
XX
AC   HQ692872;
XX
DT   25-JAN-2011 (Rel. 107, Created)
DT   24-OCT-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-C*07new allele, exons 1
DE   through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1195
RX   DOI; 10.1111/j.1399-0039.2011.01664.x.
RX   PUBMED; 21410657.
RA   Jakubauskas A., Juskevicius D., Griskevicius L.;
RT   "C*07:185, a novel HLA-C*07 allele identified by sequence-based typing";
RL   Tissue Antigens 78(2):155-156(2011).
XX
RN   [2]
RP   1-1195
RA   Jakubauskas A., Juskevicius D., Griskevicius L.;
RT   ;
RL   Submitted (08-DEC-2010) to the INSDC.
RL   Molecular and Regenerative Medicine, Vilnius University Hospital,
RL   Santariskiu 2, Vilnius LT08661, Lithuania
XX
DR   MD5; b5d9750dff5a290ae2124f22446651d9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1195
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1195
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07new"
FT   mRNA            join(<1..73,174..443,544..819,920..>1195)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07new"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,174..443,544..819,920..>1195)
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:E9NPN4"
FT                   /db_xref="IMGT/HLA:C*07:185"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:E9NPN4"
FT                   /protein_id="ADV59920.1"
FT                   /translation="MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRN
FT                   LRGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   PQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHMQHEGLQEPLTLSW"
FT   exon            <1..73
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07new"
FT                   /number=1
FT   gap             74..173
FT                   /estimated_length=unknown
FT   exon            174..443
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07new"
FT                   /number=2
FT   gap             444..543
FT                   /estimated_length=unknown
FT   exon            544..819
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07new"
FT                   /number=3
FT   gap             820..919
FT                   /estimated_length=unknown
FT   exon            920..>1195
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07new"
FT                   /number=4
XX
SQ   Sequence 1195 BP; 175 A; 291 C; 307 G; 122 T; 300 other;
     atgcgggtca tggcgccccg agccctcctc ctgctgctct cgggaggcct ggccctgacc        60
     gagacctggg cctnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttcgaca ccgccgtgtc ccggcccggc cgcggagagc cccgcttcat       240
     ctcagtgggc tacgtggacg acacgcagtt cgtgcggttc gacagcgacg ccgcgagtcc       300
     gagaggggag ccgcgggcgc cgtgggtgga gcaggagggg ccggagtatt gggaccggga       360
     gacacagaag tacaagcgcc aggcacaggc tgaccgagtg agcctgcgga acctgcgcgg       420
     ctactacaac cagagcgagg acgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnggtctca caccctccag aggatgtctg gctgcgacct ggggcccgac gggcgcctcc       600
     tccgcgggta tgaccagtcc gcctacgacg gcaaggatta catcgccctg aacgaggacc       660
     tgcgctcctg gaccgccgcg gacaccgcgc ctcagatcac ccagcgcaag ttggaggcgg       720
     cccgtgcggc ggagcagctg agagcctacc tggagggcac gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag gagacgctgc agcgcgcagn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna acccccaaag acacacgtga cccaccaccc cctctctgac       960
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc      1020
     tggcagcggg atggggagga ccagacccag gacaccgagc ttgtggagac caggccagca      1080
     ggagatggaa ccttccagaa gtgggcagct gtggtggtgc cttctggaca agagcagaga      1140
     tacacgtgcc atatgcagca cgaggggctg caagagcccc tcaccctgag ctggg           1195
//