Dbfetch

ID   HQ677626; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   HQ677626;
XX
DT   27-JUN-2011 (Rel. 109, Created)
DT   27-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*09new allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Liu M.;
RT   "Identification of an HLA-DRB1*09 allele variant in a Chinese donor";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Liu M.;
RT   ;
RL   Submitted (03-DEC-2010) to the INSDC.
RL   Shaanxi Blood Center, HLA Lab, 407 Zhuque, Xi`an, Shaaxi 710061, China
XX
DR   MD5; d5517d1ac5463ac9634019ee585e1868.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*09new"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*09new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*09new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:F8STB1"
FT                   /db_xref="IMGT/HLA:DRB1*09:11"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:F8STB1"
FT                   /protein_id="AEI60183.1"
FT                   /translation="RFLKQDKFECHFFNGTERVRYLHRGIYNQEENVRFDSDGGEYRAV
FT                   TELGRPVAESWNSQKDFLERRRAEVDTVCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*09new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 60 A; 61 C; 103 G; 46 T; 0 other;
     cacgtttctt gaagcaggat aagtttgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggtatctgca cagaggcatc tataaccaag aggagaacgt gcgcttcgac agcgacgggg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacttcct ggagcggagg cgggccgagg tggacaccgt gtgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagaggcgag                                        270
//