spacer

EBI Dbfetch

ID   HQ662947; SV 1; linear; genomic DNA; STD; HUM; 789 BP.
XX
AC   HQ662947;
XX
DT   29-DEC-2010 (Rel. 107, Created)
DT   29-DEC-2010 (Rel. 107, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*44:27var allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-789
RA   Recker K., Fuerst D., Mytilineos J.;
RT   "A new variant of HLA-B*44:27";
RL   Unpublished.
XX
RN   [2]
RP   1-789
RA   Recker K., Fuerst D., Mytilineos J.;
RT   ;
RL   Submitted (30-NOV-2010) to the INSDC.
RL   Transplantation Immunology, IKT Ulm, Helmholtzstrasse 10, Ulm 89081,
RL   Germany
XX
DR   MD5; 41942ac08d048b1a3e9dfbfbf7fba8ee.
DR   Ensembl-Gn; ENSG00000228964; homo_sapiens.
DR   Ensembl-Tr; ENST00000421349; homo_sapiens.
DR   Ensembl-Tr; ENST00000445610; homo_sapiens.
DR   Ensembl-Tr; ENST00000498484; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..789
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>789
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44:27var"
FT   mRNA            join(<1..270,514..>789)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44:27var"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,514..>789)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44:27var"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:E7EDN6"
FT                   /db_xref="IMGT/HLA:B*44:27:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:E7EDN6"
FT                   /protein_id="ADU18506.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGP
FT                   DGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGLC
FT                   VESLRRYLENGKETLQRA"
XX
SQ   Sequence 789 BP; 144 A; 263 C; 280 G; 102 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagaac ctgcgcaccg       240
     cgctccgcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ccccgaggcc gcgggacccg cccagaccct cgaccggcga gagccccagg cgcgtttacc       420
     cggtttcatt ttcagttgag gccaaaatcc ccgcgggttg gtcggggcgg ggcggggctc       480
     gggggacggg gctgaccgcg gggccggggc cagggtctca catcatccag aggatgtacg       540
     gctgcgacgt ggggccggac gggcgcctcc tccgcgggta tgaccaggac gcctacgacg       600
     gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg gacaccgcgg       660
     ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcaggac agagcctacc       720
     tggagggcct gtgcgtggag tcgctccgca gatacctgga gaatgggaag gagacgctgc       780
     agcgcgcgg                                                               789
//


spacer
spacer