spacer

EBI Dbfetch

ID   HQ662946; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   HQ662946;
XX
DT   29-DEC-2010 (Rel. 107, Created)
DT   29-DEC-2010 (Rel. 107, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1*05:var allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Recker K., Fuerst D., Mytilineos J.;
RT   "A new variant of HLA-DQB1*05";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Recker K., Fuerst D., Mytilineos J.;
RT   ;
RL   Submitted (25-NOV-2010) to the INSDC.
RL   Transplantation Immunology, IKT Ulm, Helmholtzstrasse 10, Ulm 89081,
RL   Germany
XX
DR   MD5; 2f661bc875a2dd801e40068f14318c03.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*05:var"
FT   mRNA            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*05:var"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*05:var"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:E7EDN5"
FT                   /db_xref="IMGT/HLA:DQB1*05:11:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:E7EDN5"
FT                   /protein_id="ADU18505.1"
FT                   /translation="DFVYQFKGLCYFTNGTERVRGVTRHIYNREEYARFDSDVGVYRAV
FT                   TPQGRPVAEYWNSQKEVLEGARASVDRVCRHNYEVAYRGILQRR"
XX
SQ   Sequence 270 BP; 58 A; 66 C; 104 G; 42 T; 0 other;
     aggatttcgt gtaccagttt aagggcctgt gctacttcac caacgggacg gagcgcgtgc        60
     ggggtgtgac cagacacatc tataaccgag aggagtacgc acgcttcgac agcgacgtgg       120
     gggtgtaccg ggcagtgacg ccgcaggggc ggcctgttgc cgagtactgg aacagccaga       180
     aggaagtcct ggagggggcc cgggcgtcgg tggacagggt gtgcagacac aactacgagg       240
     tggcgtaccg cgggatcctg cagaggagag                                        270
//


spacer
spacer