spacer

EBI Dbfetch

ID   HQ657212; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   HQ657212;
XX
DT   04-JUL-2011 (Rel. 109, Created)
DT   07-APR-2013 (Rel. 116, Last updated, Version 2)
XX
DE   Homo sapiens isolate 5351000159 MHC class I antigen (HLA-B) gene, exons 2,
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   PUBMED; 22715903.
RA   Jiao S.X., Liu X.H., Chi X.Y., Zhao L., Feng Z.H.;
RT   "Identification of a novel HLA-B*46 allele, B*46:01:07, in a Chinese
RT   individual";
RL   Tissue Antigens 80(3):272-273(2012).
XX
RN   [2]
RP   1-646
RA   Jiao S.-X., Feng Z.-H., Hu B., Chi X.-Y., Li C.-Y., Sun X.-M., Du Z.-H.,
RA   Zhao L.;
RT   "A novel HLA-B allele identified by sequence-based typing in a Chinese bone
RT   marrow donor";
RL   Unpublished.
XX
RN   [3]
RP   1-646
RA   Jiao S.-X., Feng Z.-H., Hu B., Chi X.-Y., Li C.-Y., Sun X.-M., Du Z.-H.,
RA   Zhao L.;
RT   ;
RL   Submitted (28-NOV-2010) to the INSDC.
RL   Qingdao HLA Typing Lab, Qingdao Blood Center, 9 Longde Road, Qingdao,
RL   Shandong 266071, P.R. China
XX
DR   MD5; 1f0c6f1e079d7e73cdb517c023abbece.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /isolate="5351000159"
FT                   /mol_type="genomic DNA"
FT                   /country="China"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-B"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:F8SNU5"
FT                   /db_xref="IMGT/HLA:B*46:01:07"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:F8SNU5"
FT                   /protein_id="AEJ10022.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            <1..270
FT                   /gene="HLA-B"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..>646
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 646 BP; 108 A; 172 C; 197 G; 69 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtacggct gcgacgtggg gcccgacggg       420
     cgcctcctcc gcgggcatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgcggcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagtggaga gcctacctgg agggcctgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer