Dbfetch

ID   HQ623150; SV 1; linear; genomic DNA; STD; HUM; 792 BP.
XX
AC   HQ623150;
XX
DT   21-JUN-2011 (Rel. 109, Created)
DT   27-APR-2012 (Rel. 112, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-C*16 new allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-792
RX   DOI; 10.1111/j.1399-0039.2011.01778.x.
RX   PUBMED; 22035606.
RA   Testi M., Galluccio T., Stellitano C., Guagnano A., Andreani M.;
RT   "Characterization of the novel HLA-C*16:07:02 allele in a family of Benin
RT   origin";
RL   Tissue Antigens 79(2):140-141(2012).
XX
RN   [2]
RP   1-792
RA   Testi M., Andreani M., Galluccio T., Stellitano C., Di Luzio A.;
RT   "Characterization of a novel HLA-C*16 allele in a family of Benin origin";
RL   Unpublished.
XX
RN   [3]
RP   1-792
RA   Testi M., Andreani M., Galluccio T., Stellitano C., Di Luzio A.;
RT   ;
RL   Submitted (16-NOV-2010) to the INSDC.
RL   Tor Vergata Hospital, LIBT Fondazione IME, viale Oxford 81, Rome, RM 00133,
RL   Italy
XX
DR   MD5; d2423123c1986ad92140785a54993ad2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..792
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>792
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*16 new"
FT   mRNA            join(<1..270,517..>792)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*16 new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,517..>792)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*16 new"
FT                   /product="MHC class I antigen"
FT                   /note="HLA-C16 antigen"
FT                   /db_xref="GOA:F8SHX7"
FT                   /db_xref="IMGT/HLA:C*16:07:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:F8SHX7"
FT                   /protein_id="AEH41458.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   gap             271..516
FT                   /estimated_length=246
XX
SQ   Sequence 792 BP; 106 A; 173 C; 199 G; 68 T; 246 other;
     gctcccactc catgaggtat ttctacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnggtc tcacaccctc cagaggatgt       540
     atggctgcga cctggggccc gacgggcgcc tcctccgcgg gtatgaccag tccgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg acctgcgctc ctggaccgcc gcggacacgg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtgc ggcggagcag cagagagcct       720
     acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggagacgc       780
     tgcagcgcgc gg                                                           792
//