spacer

EBI Dbfetch

ID   HQ602760; SV 1; linear; genomic DNA; STD; HUM; 652 BP.
XX
AC   HQ602760;
XX
DT   31-MAY-2011 (Rel. 109, Created)
DT   27-APR-2012 (Rel. 112, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1*06new allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-652
RX   DOI; 10.1111/j.1399-0039.2011.01729.x.
RX   PUBMED; 21707546.
RA   Tao S.D., Wang W., Zhu F.M., Lv H.J., Yan L.X.;
RT   "Sequence-based HLA high-resolution typing of a bone marrow donor/recipient
RT   pair shows the novel HLA allele DQB1*06:43";
RL   Tissue Antigens 78(6):461-462(2011).
XX
RN   [2]
RP   1-652
RA   Zhu F., Wang W., He Y., Yan L.;
RT   "Identified a novel HLA-DQB1*06 by PCR-SBT";
RL   Unpublished.
XX
RN   [3]
RP   1-652
RA   Zhu F., Wang W., He Y., Yan L.;
RT   ;
RL   Submitted (11-NOV-2010) to the INSDC.
RL   HLA Laboratory, Transfusion Institute, Blood Center of Zhejiang Province,
RL   Wulin Road 345, Hangzhou, Zhejiang 310006, China
XX
DR   MD5; 35ddfd73eed9ffd3a9ce6c396eb8e48b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..652
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>652
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06new"
FT   mRNA            join(<1..270,371..>652)
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06new"
FT                   /product="MHC class II antigen"
FT   CDS             join(<1..270,371..>652)
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:F6KSN0"
FT                   /db_xref="IMGT/HLA:DQB1*06:43"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:F6KSN0"
FT                   /protein_id="AEF97827.1"
FT                   /translation="DFVLQFKAMCYFTNGTERVRYVTRYIYNREEDVRFDSDVGVYRAV
FT                   TPQGRPDAEYWNSQKDILERTRVELDTVCRHNYEVAFRGILQRRVEPTVTISPSRTEAL
FT                   NHHNLLVCSVTDFYPGQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQHG
FT                   DVYTCHVEHPSLQSPITVEW"
FT   gap             271..370
FT                   /estimated_length=unknown
XX
SQ   Sequence 652 BP; 124 A; 155 C; 172 G; 101 T; 100 other;
     aggatttcgt gctccagttt aaggccatgt gctacttcac caatgggacg gagcgcgtgc        60
     gttatgtgac cagatacatc tataaccgag aggaggacgt gcgcttcgac agcgacgtgg       120
     gggtgtatcg ggcggtgacg ccgcaggggc ggcctgacgc cgagtactgg aacagccaga       180
     aggacatcct ggagaggacc cgagtggagt tggacacggt gtgcagacac aactacgagg       240
     tggcgttccg cgggatcttg cagaggagag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tggagcccac agtgaccatc tccccatcca ggacagaggc cctcaaccac       420
     cacaacctgc tggtctgctc ggtgacagat ttctatccag gccagatcaa agtccggtgg       480
     tttcggaatg accaggagga gacagctggc gttgtgtcca ccccccttat taggaacggt       540
     gactggacct tccagatcct ggtgatgctg gaaatgactc cccagcatgg agacgtctac       600
     acctgccacg tggagcaccc cagcctccag agccccatca ccgtggagtg gc               652
//


spacer
spacer