spacer

EBI Dbfetch

ID   HQ593140; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   HQ593140;
XX
DT   22-MAY-2011 (Rel. 108, Created)
DT   24-OCT-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Homo sapiens clone KZ145.1 MHC class I antigen (HLA-B) gene, HLA-B*55:01
DE   variant allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RX   DOI; 10.1111/j.1399-0039.2011.01681.x.
RX   PUBMED; 21732918.
RA   Kuranov A.B., Mukhamedyarov D.A., Momynaliev K.T.;
RT   "Characterization of new HLA-A and -B alleles from Kazakhstan";
RL   Tissue Antigens 78(3):217-218(2011).
XX
RN   [2]
RP   1-791
RA   Momynaliev K., Kuranov A., Mukhamedyarov D.;
RT   ;
RL   Submitted (08-NOV-2010) to the INSDC.
RL   Open Biotechnology Lab, National Center for Biotechnology, Valikhanov srt,
RL   13/1, Astana 010000, Kazakhstan
XX
DR   MD5; bf6a7646d2d278811511d78e931272a2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="Kazakhstan"
FT                   /clone="KZ145.1"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55:01 variant"
FT   mRNA            join(<1..270,516..>791)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55:01 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,516..>791)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55:01 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:F6KS43"
FT                   /db_xref="IMGT/HLA:B*55:01:07"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:F6KS43"
FT                   /protein_id="AEF12649.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTWQTMYGCDLGP
FT                   DGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            <1..>270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55:01 variant"
FT                   /number=2
FT   gap             271..515
FT                   /estimated_length=245
FT   exon            <516..>791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55:01 variant"
FT                   /number=3
XX
SQ   Sequence 791 BP; 113 A; 168 C; 196 G; 69 T; 245 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnggtct cacacgtggc agacgatgta       540
     tggctgcgac ctggggccgg acgggcgcct cctccgcggg cataaccagt tagcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgagctcc tggaccgcgg cggacaccgc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgag gcggagcagc tgagagccta       720
     cctggagggc acgtgcgtgg agtggctccg cagatacctg gagaacggga aggagacgct       780
     gcagcgcgcg g                                                            791
//


spacer
spacer