Dbfetch

ID   HQ593136; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   HQ593136;
XX
DT   22-MAY-2011 (Rel. 108, Created)
DT   24-OCT-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Homo sapiens clone kz41.2 MHC class I antigen (HLA-B) gene, HLA-B*27:05
DE   variant allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RX   DOI; 10.1111/j.1399-0039.2011.01681.x.
RX   PUBMED; 21732918.
RA   Kuranov A.B., Mukhamedyarov D.A., Momynaliev K.T.;
RT   "Characterization of new HLA-A and -B alleles from Kazakhstan";
RL   Tissue Antigens 78(3):217-218(2011).
XX
RN   [2]
RP   1-791
RA   Momynaliev K., Kuranov A., Mukhamedyarov D.;
RT   ;
RL   Submitted (08-NOV-2010) to the INSDC.
RL   Open Biotechnology Lab, National Center for Biotechnology, Valikhanov srt,
RL   13/1, Astana 010000, Kazakhstan
XX
DR   MD5; f01c6843b9557d714c1fb0ede4d10c0a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="Kazakhstan"
FT                   /clone="kz41.2"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27:05 variant"
FT   mRNA            join(<1..270,516..>791)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27:05 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,516..>791)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27:05 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*27:74"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:F6KS39"
FT                   /protein_id="AEF12645.1"
FT                   /translation="SHSMRYFHTFVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGP
FT                   DGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            <1..>270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27:05 variant"
FT                   /number=2
FT   gap             271..515
FT                   /estimated_length=245
FT   exon            <516..>791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27:05 variant"
FT                   /number=3
XX
SQ   Sequence 791 BP; 108 A; 171 C; 195 G; 72 T; 245 other;
     gctcccactc catgaggtat ttccacacct tcgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctgc aaggccaagg cacagactga ccgagaggac ctgcggaccc       240
     tgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnggtct cacaccctcc agaatatgta       540
     tggctgcgac gtggggccgg acgggcgcct cctccgcggg taccaccagg acgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgagctcc tggaccgccg cggacacggc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgtg gcggagcagc tgagagccta       720
     cctggagggc gagtgcgtgg agtggctccg cagatacctg gagaacggga aggagacgct       780
     gcagcgcgcg g                                                            791
//