spacer

EBI Dbfetch

ID   HQ589111; SV 1; linear; genomic DNA; STD; HUM; 652 BP.
XX
AC   HQ589111;
XX
DT   15-MAR-2011 (Rel. 108, Created)
DT   15-MAR-2011 (Rel. 108, Last updated, Version 1)
XX
DE   Homo sapiens isolate cell ID D10013402 MHC class I antigen (HLA-DQB) gene,
DE   HLA-DQB1*06:03:01 variant allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-652
RA   Qu J., Li J., Chen H., Zheng Z., Liao K., Wang L., Zhou M., Huang C.,
RA   Hu Z., Yin J., Deng X., Cen Y., Zhang W., Zhang M., Tang J., Liang J.,
RA   Cheng Z., Long Y., Lan Z., Ye M., Zhen H., Zhang H., Tian Z., Hua S.,
RA   Tao D., Chen C., Pan J., Liu X., Xue Y., Wu S., Zhang K., Zhu H., Huang H.,
RA   Zhou C., Yang X., Ni J., Mai L., Zheng K., Liu B., Tang L., Zhang L.,
RA   Shen M., Huang J., Song X., Yi X., Wen J., Qian P., Wang Y., Wu D., Fan Z.,
RA   Zheng M., Liu P.;
RT   "Identification of novel HLA alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-652
RA   Qu J., Li J., Chen H., Zheng Z., Liao K., Wang L., Zhou M., Huang C.,
RA   Hu Z., Yin J., Deng X., Cen Y., Zhang W., Zhang M., Tang J., Liang J.,
RA   Cheng Z., Long Y., Lan Z., Ye M., Zhen H., Zhang H., Tian Z., Hua S.,
RA   Tao D., Chen C., Pan J., Liu X., Xue Y., Wu S., Zhang K., Zhu H., Huang H.,
RA   Zhou C., Yang X., Ni J., Mai L., Zheng K., Liu B., Tang L., Zhang L.,
RA   Shen M., Huang J., Song X., Yi X., Wen J., Qian P., Wang Y., Wu D., Fan Z.,
RA   Zheng M., Liu P.;
RT   ;
RL   Submitted (08-NOV-2010) to the INSDC.
RL   Healthcare Dep., BGI, Beishan Industrial Zone, Yantian District, Shenzhen,
RL   Guangdong 518083, China
XX
DR   MD5; bd919e800fef6efa0b9bf8b5dbc6f734.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..652
FT                   /organism="Homo sapiens"
FT                   /isolate="cell ID D10013402"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>652
FT                   /gene="HLA-DQB"
FT                   /allele="HLA-DQB1*06:03:01 variant"
FT   mRNA            join(<1..270,371..>652)
FT                   /gene="HLA-DQB"
FT                   /allele="HLA-DQB1*06:03:01 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>652)
FT                   /codon_start=3
FT                   /gene="HLA-DQB"
FT                   /allele="HLA-DQB1*06:03:01 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:F2XI67"
FT                   /db_xref="IMGT/HLA:DQB1*06:41"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:F2XI67"
FT                   /protein_id="ADZ38977.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRLVTRHIYNREEYARFDSDVGVYRAV
FT                   TPQGRPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRRVEPTVTISPSRTEAL
FT                   NHHNLLVCSVTDFYPGQIKVQWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRG
FT                   DVYTCHVEHPSLQSPITVEW"
FT   gap             271..370
FT                   /estimated_length=unknown
XX
SQ   Sequence 652 BP; 123 A; 155 C; 173 G; 101 T; 100 other;
     aggatttcgt gtaccagttt aagggcatgt gctacttcac caacgggacg gagcgcgtgc        60
     gtcttgtaac cagacacatc tataaccgag aggagtacgc gcgcttcgac agcgacgtgg       120
     gggtgtaccg cgcggtgacg ccgcaggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggaagtcct ggaggggacc cgggcggagt tggacacggt gtgcagacac aactacgagg       240
     tggcgttccg cgggatcttg cagaggagag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tggagcccac agtgaccatc tccccatcca ggacagaggc cctcaaccac       420
     cacaacctgc tggtctgctc ggtgacagat ttctatccag gccagatcaa agtccagtgg       480
     tttcggaatg atcaggagga gacagccggc gttgtgtcca ccccccttat taggaatggt       540
     gactggactt tccagatcct ggtgatgctg gaaatgactc cccagcgtgg agatgtctac       600
     acctgccacg tggagcaccc cagcctccag agccccatca ccgtggagtg gc               652
//


spacer
spacer