spacer

EBI Dbfetch

ID   HQ589102; SV 1; linear; genomic DNA; STD; HUM; 1375 BP.
XX
AC   HQ589102;
XX
DT   15-MAR-2011 (Rel. 108, Created)
DT   15-MAR-2011 (Rel. 108, Last updated, Version 1)
XX
DE   Homo sapiens isolate cell ID D10015710 MHC class I antigen (HLA-C) gene,
DE   HLA-C*08:01:01 variant allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1375
RA   Qu J., Li J., Chen H., Zheng Z., Liao K., Wang L., Zhou M., Huang C.,
RA   Hu Z., Yin J., Deng X., Cen Y., Zhang W., Zhang M., Tang J., Liang J.,
RA   Cheng Z., Long Y., Lan Z., Ye M., Zhen H., Zhang H., Tian Z., Hua S.,
RA   Tao D., Chen C., Pan J., Liu X., Xue Y., Wu S., Zhang K., Zhu H., Huang H.,
RA   Zhou C., Yang X., Ni J., Mai L., Zheng K., Liu B., Tang L., Zhang L.,
RA   Shen M., Huang J., Song X., Yi X., Wen J., Qian P., Wang Y., Wu D., Fan Z.,
RA   Zheng M., Liu P.;
RT   "Identification of novel HLA alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-1375
RA   Qu J., Li J., Chen H., Zheng Z., Liao K., Wang L., Zhou M., Huang C.,
RA   Hu Z., Yin J., Deng X., Cen Y., Zhang W., Zhang M., Tang J., Liang J.,
RA   Cheng Z., Long Y., Lan Z., Ye M., Zhen H., Zhang H., Tian Z., Hua S.,
RA   Tao D., Chen C., Pan J., Liu X., Xue Y., Wu S., Zhang K., Zhu H., Huang H.,
RA   Zhou C., Yang X., Ni J., Mai L., Zheng K., Liu B., Tang L., Zhang L.,
RA   Shen M., Huang J., Song X., Yi X., Wen J., Qian P., Wang Y., Wu D., Fan Z.,
RA   Zheng M., Liu P.;
RT   ;
RL   Submitted (08-NOV-2010) to the INSDC.
RL   Healthcare Dep., BGI, Beishan Industrial Zone, Yantian District, Shenzhen,
RL   Guangdong 518083, China
XX
DR   MD5; 4de1d2c5a419361bc6561fd3aa55c0fc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1375
FT                   /organism="Homo sapiens"
FT                   /isolate="cell ID D10015710"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1375
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08:01:01 variant"
FT   mRNA            join(<1..270,371..646,747..1022,1123..1242,1343..>1375)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08:01:01 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..646,747..1022,1123..1242,1343..>1375)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08:01:01 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:F2XI58"
FT                   /db_xref="IMGT/HLA:C*08:01:04"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:F2XI58"
FT                   /protein_id="ADZ38968.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARTAEQLRAYLEGTC
FT                   VEWLRRYLENGKKTLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWGPSSQPTI
FT                   PIVGIVAGLAVLAVLAVLGAVMAVVMCRRKSSGGKGGSCSQAA"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   gap             647..746
FT                   /estimated_length=unknown
FT   gap             1023..1122
FT                   /estimated_length=unknown
FT   gap             1243..1342
FT                   /estimated_length=unknown
XX
SQ   Sequence 1375 BP; 198 A; 295 C; 333 G; 149 T; 400 other;
     gctcccactc catgaggtat ttctacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcagttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtatggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtataa ccagttcgcc tacgacggca aggattacat cgccctgaat       480
     gaggacctgc gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtacggcgga gcagctgaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaagaag acgctgcagc gcgcggnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnaaca cccaaagaca cacgtgaccc accatcccgt       780
     ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac       840
     actgacctgg cagcgggatg gcgaggacca aactcaggac accgagcttg tggagaccag       900
     gccagcagga gatggaacct tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga       960
     gcagagatac acctgccatg tgcagcacga ggggctgcca gagcccctca ccctgagatg      1020
     ggnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnggccatct tcccagccca      1140
     ccatccccat cgtgggcatc gttgctggcc tggctgtcct ggctgtccta gctgtcctag      1200
     gagctgtgat ggctgttgtg atgtgtagga ggaagagctc agnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nngtggaaaa ggagggagct gctctcaggc tgcgt           1375
//


spacer
spacer