spacer

EBI Dbfetch

ID   HQ589082; SV 1; linear; genomic DNA; STD; HUM; 1022 BP.
XX
AC   HQ589082;
XX
DT   15-MAR-2011 (Rel. 108, Created)
DT   15-MAR-2011 (Rel. 108, Last updated, Version 1)
XX
DE   Homo sapiens isolate cell ID D10014542 MHC class I antigen (HLA-B) gene,
DE   HLA-B*40:02:01 variant allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1022
RA   Qu J., Li J., Chen H., Zheng Z., Liao K., Wang L., Zhou M., Huang C.,
RA   Hu Z., Yin J., Deng X., Cen Y., Zhang W., Zhang M., Tang J., Liang J.,
RA   Cheng Z., Long Y., Lan Z., Ye M., Zhen H., Zhang H., Tian Z., Hua S.,
RA   Tao D., Chen C., Pan J., Liu X., Xue Y., Wu S., Zhang K., Zhu H., Huang H.,
RA   Zhou C., Yang X., Ni J., Mai L., Zheng K., Liu B., Tang L., Zhang L.,
RA   Shen M., Huang J., Song X., Yi X., Wen J., Qian P., Wang Y., Wu D., Fan Z.,
RA   Zheng M., Liu P.;
RT   "Identification of novel HLA alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-1022
RA   Qu J., Li J., Chen H., Zheng Z., Liao K., Wang L., Zhou M., Huang C.,
RA   Hu Z., Yin J., Deng X., Cen Y., Zhang W., Zhang M., Tang J., Liang J.,
RA   Cheng Z., Long Y., Lan Z., Ye M., Zhen H., Zhang H., Tian Z., Hua S.,
RA   Tao D., Chen C., Pan J., Liu X., Xue Y., Wu S., Zhang K., Zhu H., Huang H.,
RA   Zhou C., Yang X., Ni J., Mai L., Zheng K., Liu B., Tang L., Zhang L.,
RA   Shen M., Huang J., Song X., Yi X., Wen J., Qian P., Wang Y., Wu D., Fan Z.,
RA   Zheng M., Liu P.;
RT   ;
RL   Submitted (08-NOV-2010) to the INSDC.
RL   Healthcare Dep., BGI, Beishan Industrial Zone, Yantian District, Shenzhen,
RL   Guangdong 518083, China
XX
DR   MD5; d4568c7dbf12a236f75060f9f1c0ffbc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1022
FT                   /organism="Homo sapiens"
FT                   /isolate="cell ID D10014542"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1022
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:02:01 variant"
FT   mRNA            join(<1..270,371..646,747..>1022)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:02:01 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..646,747..>1022)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40:02:01 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:F2XI38"
FT                   /db_xref="IMGT/HLA:B*40:02:12"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:F2XI38"
FT                   /protein_id="ADZ38948.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   gap             647..746
FT                   /estimated_length=unknown
XX
SQ   Sequence 1022 BP; 181 A; 257 C; 272 G; 112 T; 200 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagccac        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagc atgtacggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggcataa ccagtacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcagctgaga gcctacctgg agggcgagtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcggnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnaccc cccaaagaca cacgtgaccc accaccccat       780
     ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac       840
     actgacctgg cagcgggatg gcgaggacca aactcaggac actgagcttg tggagaccag       900
     accagcagga gatagaacct tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga       960
     gcagagatac acatgccatg tacagcatga ggggctgccg aagcccctca ccctgagatg      1020
     gg                                                                     1022
//


spacer
spacer