Dbfetch

ID   HQ538841; SV 1; linear; genomic DNA; STD; HUM; 863 BP.
XX
AC   HQ538841;
XX
DT   16-FEB-2011 (Rel. 107, Created)
DT   16-FEB-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*11 allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-863
RA   Balas A., Garcia-Sanchez F., Vicario J.L.;
RT   "Sequencing of a novel DRB1*11 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-863
RA   Balas A., Garcia-Sanchez F., Vicario J.L.;
RT   ;
RL   Submitted (03-NOV-2010) to the INSDC.
RL   Histocompatibility, CTM, Avenida de la Democracia, Madrid 28032, Spain
XX
DR   MD5; 43f771491efed960d4c940f38b596779.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..863
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>863
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11"
FT   mRNA            join(<1..270,371..652,753..>863)
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11"
FT                   /product="MHC class II antigen"
FT   CDS             join(<1..270,371..652,753..>863)
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:F1CT76"
FT                   /db_xref="IMGT/HLA:DRB1*11:46:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:F1CT76"
FT                   /protein_id="ADX31869.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPL
FT                   QHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSG
FT                   EVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQK"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   gap             653..752
FT                   /estimated_length=unknown
XX
SQ   Sequence 863 BP; 146 A; 163 C; 215 G; 139 T; 200 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tccatcctaa ggtgactgtg tatccttcaa agacccagcc cctgcagcac       420
     cacaacctcc tggtctgttc tgtgagtggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaatg gccaggaaga gaagactggg gtggtgtcca caggcctgat ccacaatgga       540
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcggagtgg agaggtttac       600
     acctgccaag tggagcaccc aagcgtgaca agccctctca cagtggaatg gannnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nngagcacgg tctgaatctg cacagagcaa       780
     gatgctgagt ggagtcgggg gctttgtgct gggcctgctc ttccttgggg ccgggctgtt       840
     catctacttc aggaatcaga aag                                               863
//