spacer

EBI Dbfetch

ID   HQ450153; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   HQ450153;
XX
DT   02-MAY-2011 (Rel. 108, Created)
DT   02-MAY-2011 (Rel. 108, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPB1) gene, HLA-DPB1*03:03:01
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Qu J., Li L., Chen H., Zhou M., Shen M., Wang L., Liao K., Huang C.,
RA   Deng X., Cheng Z., Yin J., Zhang M., Liu X., Xue Y., Zheng Z., Huang J.,
RA   Song X., Yi X., Wang J., Wen J., Wang J.;
RT   "Identification of novel HLA alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-646
RA   Qu J., Li L., Chen H., Zhou M., Shen M., Wang L., Liao K., Huang C.,
RA   Deng X., Cheng Z., Yin J., Zhang M., Liu X., Xue Y., Zheng Z., Huang J.,
RA   Song X., Yi X., Wang J., Wen J., Wang J.;
RT   ;
RL   Submitted (26-OCT-2010) to the INSDC.
RL   Healthcare Dep., BGI, Beishan Industrial Zone, Yantian District, Shenzhen
RL   518083, China, Shenzhen, Guangdong 518083, China
XX
DR   MD5; aace0ba982d11680f1a6a571c624c824.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /isolate="cell ID LD001981"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*03:03:01"
FT   mRNA            join(<1..264,365..>646)
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*03:03:01"
FT                   /product="MHC class II antigen"
FT   CDS             join(<1..264,365..>646)
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*03:03:01"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:F5ATB2"
FT                   /db_xref="IMGT/HLA:DPB1*132:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:F5ATB2"
FT                   /protein_id="AEC33255.1"
FT                   /translation="NYVYQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEDYWNSQKDILEEKRAVPDRVCRHNYELDEAVTLQRRVQPKVNVSPSKKGPLQH
FT                   HNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDV
FT                   YICQVEHTSLDSPVTVEW"
FT   gap             265..364
FT                   /estimated_length=unknown
XX
SQ   Sequence 646 BP; 131 A; 148 C; 172 G; 95 T; 100 other;
     agaattacgt gtaccagtta cggcaggaat gctacgcgtt taatgggaca cagcgcttcc        60
     tggagagata catctacaac cgggaggagt tcgtgcgctt cgacagcgac gtgggggagt       120
     tccgggcggt gacggagctg gggcggcctg atgaggacta ctggaacagc cagaaggaca       180
     tcctggagga gaagcgggca gtgccggaca gggtatgcag acacaactac gagctggacg       240
     aggccgtgac cctgcagcgc cgagnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnntccagc ctaaggtgaa cgtttccccc tccaagaagg ggcccctgca gcaccacaac       420
     ctgcttgtct gccacgtgac agatttctac ccaggcagca ttcaagtccg atggttcctg       480
     aatggacagg aggaaacagc tggggtcgtg tccaccaacc tgatccgtaa tggagactgg       540
     accttccaga tcctggtgat gctggaaatg accccccagc agggagacgt ctacatctgc       600
     caagtggagc acaccagcct ggacagtcct gtcaccgtgg agtgga                      646
//


spacer
spacer