Dbfetch

ID   HQ450152; SV 1; linear; genomic DNA; STD; HUM; 1195 BP.
XX
AC   HQ450152;
XX
DT   02-MAY-2011 (Rel. 108, Created)
DT   02-MAY-2011 (Rel. 108, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*35:42:01 allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1195
RA   Qu J., Li L., Chen H., Zhou M., Shen M., Wang L., Liao K., Huang C.,
RA   Deng X., Cheng Z., Yin J., Zhang M., Liu X., Xue Y., Zheng Z., Huang J.,
RA   Song X., Yi X., Wang J., Wen J., Wang J.;
RT   "Identification of novel HLA alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-1195
RA   Qu J., Li L., Chen H., Zhou M., Shen M., Wang L., Liao K., Huang C.,
RA   Deng X., Cheng Z., Yin J., Zhang M., Liu X., Xue Y., Zheng Z., Huang J.,
RA   Song X., Yi X., Wang J., Wen J., Wang J.;
RT   ;
RL   Submitted (26-OCT-2010) to the INSDC.
RL   Healthcare Dep., BGI, Beishan Industrial Zone, Yantian District, Shenzhen
RL   518083, China, Shenzhen, Guangdong 518083, China
XX
DR   MD5; 74c65009ed4cc8d46252b2d7088f7703.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1195
FT                   /organism="Homo sapiens"
FT                   /isolate="cell ID D10012612"
FT                   /mol_type="genomic DNA"
FT                   /note="identical sequence found in cell IDs D10000511,
FT                   D10001768, D10003579, D10004064, D10004762, D10007375,
FT                   D10009776, D10009839, D10013556, D10014178, D10020200"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1195
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35:42:01"
FT   mRNA            join(<1..73,174..443,544..819,920..>1195)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35:42:01"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,174..443,544..819,920..>1195)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35:42:01"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*35:01:23"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:F5ATB1"
FT                   /protein_id="AEC33254.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRW"
FT   gap             74..173
FT                   /estimated_length=unknown
FT   gap             444..543
FT                   /estimated_length=unknown
FT   gap             820..919
FT                   /estimated_length=unknown
XX
SQ   Sequence 1195 BP; 187 A; 284 C; 297 G; 127 T; 300 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ctgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttctaca ccgccatgtc ccggcccggc cgcggggagc cccgcttcat       240
     cgcagtgggc tacgtggacg acacccagtt cgtgaggttc gacagcgacg ccgcgagtcc       300
     gaggacggag ccccgggcgc catggataga gcaggagggg ccggagtatt gggaccggaa       360
     cacacagatc ttcaagacca acacacagac ttaccgagag agcctgcgga acctgcgcgg       420
     ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnggtctca catcatccag aggatgtatg gctgcgacct ggggcccgac gggcgcctcc       600
     tccgcgggca tgaccagtcc gcctacgacg gcaaggatta catcgccctg aacgaggacc       660
     tgagctcctg gaccgcggcg gacaccgcgg ctcagatcac ccagcgcaag tgggaggcgg       720
     cccgtgtggc ggagcagctg agagcctacc tggagggcct gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag gagacgctgc agcgcgcggn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna ccccccaaag acacacgtga cccaccaccc cgtctctgac       960
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc      1020
     tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca      1080
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga      1140
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atggg           1195
//