spacer

EBI Dbfetch

ID   HQ450151; SV 1; linear; genomic DNA; STD; HUM; 3075 BP.
XX
AC   HQ450151;
XX
DT   02-MAY-2011 (Rel. 108, Created)
DT   02-MAY-2011 (Rel. 108, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*24:02:01:01 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3075
RA   Qu J., Li L., Chen H., Zhou M., Shen M., Wang L., Liao K., Huang C.,
RA   Deng X., Cheng Z., Yin J., Zhang M., Liu X., Xue Y., Zheng Z., Huang J.,
RA   Song X., Yi X., Wang J., Wen J., Wang J.;
RT   "Identification of novel HLA alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-3075
RA   Qu J., Li L., Chen H., Zhou M., Shen M., Wang L., Liao K., Huang C.,
RA   Deng X., Cheng Z., Yin J., Zhang M., Liu X., Xue Y., Zheng Z., Huang J.,
RA   Song X., Yi X., Wang J., Wen J., Wang J.;
RT   ;
RL   Submitted (26-OCT-2010) to the INSDC.
RL   Healthcare Dep., BGI, Beishan Industrial Zone, Yantian District, Shenzhen
RL   518083, China, Shenzhen, Guangdong 518083, China
XX
DR   MD5; a89ed5d11db1d882965e052a6a049217.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3075
FT                   /organism="Homo sapiens"
FT                   /isolate="cell ID D10008726"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2899
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24:02:01:01"
FT   mRNA            join(<1..73,204..473,715..990,1567..1842,1945..2061,
FT                   2504..2536,2679..2726,2895..>2899)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24:02:01:01"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,204..473,715..990,1567..1842,1945..2061,
FT                   2504..2536,2679..2726,2895..2899)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24:02:01:01"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q95J06"
FT                   /db_xref="IMGT/HLA:A*24:02:01:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q95J06"
FT                   /protein_id="AEC33253.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFSTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRI
FT                   ALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTVPIVGIIAGLVLLGAVITGAVVAAVMWRRNSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
XX
SQ   Sequence 3075 BP; 598 A; 881 C; 948 G; 648 T; 0 other;
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg caggtgagtg cggggtcggg agggaaacgg cctctgcggg gagaagcaag       120
     gggcccgcct ggcgggggcg caagacccgg gaagccgcgc cgggaggagg gtcgggcggg       180
     tctcagccac tcctcgtccc caggctccca ctccatgagg tatttctcca catccgtgtc       240
     ccggcccggc cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga       360
     gcaggagggg ccggagtatt gggacgagga gacagggaaa gtgaaggccc actcacagac       420
     tgaccgagag aacctgcgga tcgcgctccg ctactacaac cagagcgagg ccggtgagtg       480
     accccggccc ggggcgcagg tcacgacccc tcatccccca cggacgggcc gggtcgccca       540
     cagtctccgg gtccgagatc caccccgaag ccgcgggacc ccgagaccct tgccccggga       600
     gaggcccagg cgccttaacc cggtttcatt ttcagtttag gccaaaaatc cccccgggtt       660
     ggtcggggcc gggcggggct cgggggactg ggctgaccgc ggggtcgggg ccaggttctc       720
     acaccctcca gatgatgttt ggctgcgacg tggggtcgga cgggcgcttc ctccgcgggt       780
     accaccagta cgcctacgac ggcaaggatt acatcgccct gaaagaggac ctgcgctctt       840
     ggaccgcggc ggacatggcg gctcagatca ccaagcgcaa gtgggaggcg gcccatgtgg       900
     cggagcagca gagagcctac ctggagggca cgtgcgtgga cgggctccgc agatacctgg       960
     agaacgggaa ggagacgctg cagcgcacgg gtaccagggg ccacggggcg cctacctgat      1020
     cgcctgtagg tctcccgggc tggcctccca caaggagggg agacaattgg gaccaacact      1080
     agaatatcgc cctccctctg gtcctgaggg agaggaatcc tcctgggttt ccagatcctg      1140
     taccagagag tgactctgag gttccgccct gctctctgac acaattaagg gataaaatct      1200
     ctgacggaat gacggaaaga cgatccctcg aatactgatg actggttccc tttgacaccg      1260
     gcagcagcct tgggaccgtg acttttcctc tcaggccttg ttctctgctt cacactcaat      1320
     gtgtgtgggg gtctgagtcc agcacttctg agtccctcag cctccactca ggtcaggacc      1380
     agaagtcgct gttccctcct cagggaatag aagattatcc caggtgcctg tgtccaggct      1440
     ggtgtctggg ttctgtgctc tcttccccat cccgggtgtc ctgtccattc tcaagatggc      1500
     cacatgcatg ctggagtgtc ccatgacaga tgcaaaatgc ctgaattttc tgactcttcc      1560
     cgtcagaccc ccccaagaca catatgaccc accaccccat ctctgaccat gaggccactc      1620
     tgagatgctg ggccctgggc ttctaccctg cggagatcac actgacctgg cagcgggatg      1680
     gggaggacca gacccaggac acggagcttg tggagaccag gcctgcaggg gatggaacct      1740
     tccagaagtg ggcagctgtg gtggtacctt ctggagagga gcagagatac acctgccatg      1800
     tgcagcatga gggtctgccc aagcccctca ccctgagatg gggtaaggag ggagatgggg      1860
     gtgtcatgtc tcttagggaa agcaggagcc tctctggaga cctttagcag ggtcagggcc      1920
     cctcaccttc ccctcttttc ccagagccat cttcccagcc caccgtcccc atcgtgggca      1980
     tcattgctgg cctggttctc cttggagctg tgatcactgg agctgtggtc gctgctgtga      2040
     tgtggaggag gaacagctca ggtggagaag gggtgaaggg tggggtctga gatttcttgt      2100
     ctcactgagg gttccaagcc ccagctagaa atgtgccctg tctcattact gggaagcacc      2160
     atccacaatc atgggccgac ccagcctggg ccctgtgtgc cagcacttac tcttttgtaa      2220
     agcacctgtg acaatgaagg acagatttat caccttgatt atggcggtga tgggacctga      2280
     tcccagcagt cacaagtcac aggggaaggt ccctgacgac agatctcagg agggcgattg      2340
     gtccagggcc cacatctgct ttcttcatgt ttcctgatcc tgccctgggt ctgcagtcac      2400
     acatttctgg aaacttctct ggggtccaag actaggaggt tcctctagga ccttaaggcc      2460
     ctggctcctt tctggtatct cacaggacat tttcttccca cagatagaaa aggagggagc      2520
     tactctcagg ctgcaagtaa gtatgaagga ggctgatgcc tgaggtcctt gggatattgt      2580
     gtttgggagc ccatggggga gctcaaccac cccacaattc ctcctctagc cacatcttct      2640
     gtgggatctg accaggttct gtttttgttc taccccaggc agtgacagtg cccagggctc      2700
     tgatgtgtct ctcacagctt gtaaaggtga gagcttggag ggcctgatgt gtgttgggtg      2760
     ttgggcggaa cagtggacac agctgtgcta tggggtttct ttgcattgga tgtattgagc      2820
     atgcgatggg ctgtttaaag tgtgacccct cactgtgaca gatatgaagt tgttcatgaa      2880
     ttttttttct atagtgtgag acagctgcct tgtgtgggac tgagaggcaa gagttgttcc      2940
     tgcccttccc tttgtgactt gaagaaccct gactttgttt ctgcaaaggc acctgcatgt      3000
     gtctgtgttc atgtaggcat aatgtgagga ggtggggaga ccaccccacc cccatgtcca      3060
     ccatgaccct cttcc                                                       3075
//


spacer
spacer