Dbfetch

ID   HQ402926; SV 1; linear; genomic DNA; STD; HUM; 1637 BP.
XX
AC   HQ402926;
XX
DT   19-APR-2011 (Rel. 108, Created)
DT   19-APR-2011 (Rel. 108, Last updated, Version 1)
XX
DE   Homo sapiens cell-line CS00051 MHC class I antigen (HLA-B) gene,
DE   HLA-B*41:01V allele, exons 2 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1637
RA   Cao K., Wang Q., Layne N., Naim M., Lai C.-H., Ong G., Reinsmoen N.L.;
RT   "Novel Sequences of Allele B*41:01 Variant";
RL   Unpublished.
XX
RN   [2]
RP   1-1637
RA   Cao K., Wang Q., Layne N., Naim M., Lai C.-H., Ong G., Reinsmoen N.L.;
RT   ;
RL   Submitted (14-OCT-2010) to the INSDC.
RL   HLA Laboratory, Comprehensive Transplant Center, Department of Medicine,
RL   Cedars-Sinai Medical Center, 8723 Alden Dr. SSB 197, Los Angeles, CA 90048,
RL   USA
XX
DR   MD5; 2de274ddb1536d0caa9d87986d8935ea.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1637
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="CS00051"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1637
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*41:01V"
FT   mRNA            join(<1..270,514..789,1362..>1637)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*41:01V"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,514..789,1362..>1637)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*41:01V"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*41:17"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:F5A500"
FT                   /protein_id="AEB65786.1"
FT                   /translation="SHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTWQRMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGLC
FT                   VEWLRGYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*41:01V"
FT                   /number=2
FT   gap             271..513
FT                   /estimated_length=243
FT   exon            514..789
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*41:01V"
FT                   /number=3
FT   gap             790..1361
FT                   /estimated_length=572
FT   exon            1362..1637
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*41:01V"
FT                   /number=4
XX
SQ   Sequence 1637 BP; 180 A; 254 C; 275 G; 113 T; 815 other;
     gctcccactc catgaggtat ttccacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnggtctca cacttggcag aggatgtatg       540
     gctgcgacgt ggggccggac gggcgcctcc tccgcgggca taaccagtac gcctacgacg       600
     gcaaggatta catcgccctg aacgaggacc tgcgctcctg gaccgcggcg gacaccgcgg       660
     ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcaggac agagcctacc       720
     tggagggcct gtgcgtggag tggctccgcg gatacctgga gaacgggaag gacacgctgg       780
     agcgcgcggn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn naccccccaa agacacacgt      1380
     gacccaccac cccatctctg accatgaggc caccctgagg tgctgggccc tgggcttcta      1440
     ccctgcggag atcacactga cctggcagcg ggatggcgag gaccaaactc aggacactga      1500
     gcttgtggag accagaccag caggagatag aaccttccag aagtgggcag ctgtggtggt      1560
     gccttctgga gaagagcaga gatacacatg ccatgtacag catgaggggc tgccgaagcc      1620
     cctcaccctg agatggg                                                     1637
//