Dbfetch

ID   HQ331237; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   HQ331237;
XX
DT   04-APR-2011 (Rel. 108, Created)
DT   04-APR-2011 (Rel. 108, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*14 allele, exon
DE   2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Chang Y.-H., Ho P.-H., Chen Y.-C., Shen Y.-H., Yeh Y.-J.;
RT   "Novel DRB1*14 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Chang Y.-H., Ho P.-H., Chen Y.-C., Shen Y.-H., Yeh Y.-J.;
RT   ;
RL   Submitted (30-SEP-2010) to the INSDC.
RL   Molecular Typing Laboratory, Medigen Biotechnology Corp, Room A, 14th Floor
RL   Building F3, Yuanqu Street, Taipei 11560, Taiwan
XX
DR   MD5; 21046c92f1a90713c0a38d0f260c1f29.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14"
FT                   /product="MHC class II antigen"
FT                   /note="antigen presenting molecule"
FT                   /db_xref="GOA:F2X362"
FT                   /db_xref="IMGT/HLA:DRB1*14:104"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:F2X362"
FT                   /protein_id="AEA36768.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAV
FT                   TELGRPAAEHWNSQKDLLERRRGRVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14"
FT                   /number=2
XX
SQ   Sequence 270 BP; 53 A; 65 C; 101 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgctgc ggagcactgg aacagccaga       180
     aggacctcct ggagcggagg cggggccggg tggacaccta ttgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//