spacer

EBI Dbfetch

ID   HQ324130; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   HQ324130;
XX
DT   27-FEB-2011 (Rel. 108, Created)
DT   27-FEB-2011 (Rel. 108, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-C*14:02:01Variant
DE   allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Qu J., Li J., Chen H., Shen M., Zhou M., Wang L., Liao K., Huang C., Hu Z.,
RA   Zhang M., Zhang H., Tian Z., Wen J., Song X., Huang J., Zheng Z.;
RT   "Identification of novel HLA alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-646
RA   Qu J., Li J., Chen H., Shen M., Zhou M., Wang L., Liao K., Huang C., Hu Z.,
RA   Zhang M., Zhang H., Tian Z., Wen J., Song X., Huang J., Zheng Z.;
RT   ;
RL   Submitted (29-SEP-2010) to the INSDC.
RL   Healthcare Dep., BGI, Beishan Industrial Zone, Yantian District, Shenzhen
RL   518083, China, Shenzhen, Guangdong 518083, China
XX
DR   MD5; 6851f75da9103c28c1366fed472ad806.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="D10017227"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*14:02:01Variant"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*14:02:01Variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*14:02:01Variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:F1CK28"
FT                   /db_xref="IMGT/HLA:C*14:28:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:F1CK28"
FT                   /protein_id="ADX97429.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQRMFGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*14:02:01Variant"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*14:02:01Variant"
FT                   /number=3
XX
SQ   Sequence 646 BP; 102 A; 172 C; 201 G; 71 T; 100 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagcgg atgtttggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggatctgc gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagcggaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer