Dbfetch

ID   HQ324127; SV 1; linear; genomic DNA; STD; HUM; 652 BP.
XX
AC   HQ324127;
XX
DT   27-FEB-2011 (Rel. 108, Created)
DT   27-FEB-2011 (Rel. 108, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1*04:01:01Variant
DE   allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-652
RA   Qu J., Li J., Chen H., Shen M., Zhou M., Wang L., Liao K., Huang C., Hu Z.,
RA   Zhang M., Zhang H., Tian Z., Wen J., Song X., Huang J., Zheng Z.;
RT   "Identification of novel HLA alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-652
RA   Qu J., Li J., Chen H., Shen M., Zhou M., Wang L., Liao K., Huang C., Hu Z.,
RA   Zhang M., Zhang H., Tian Z., Wen J., Song X., Huang J., Zheng Z.;
RT   ;
RL   Submitted (29-SEP-2010) to the INSDC.
RL   Healthcare Dep., BGI, Beishan Industrial Zone, Yantian District, Shenzhen
RL   518083, China, Shenzhen, Guangdong 518083, China
XX
DR   MD5; ee78688d6a03280729e8c547fb011e9f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..652
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="D10006716"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>652
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*04:01:01Variant"
FT   mRNA            join(<1..270,371..>652)
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*04:01:01Variant"
FT                   /product="MHC class II antigen"
FT   CDS             join(<1..270,371..>652)
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*04:01:01Variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:F1CK25"
FT                   /db_xref="IMGT/HLA:DQB1*04:07"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:F1CK25"
FT                   /protein_id="ADX97426.1"
FT                   /translation="DFVFQFKGMCYFTNGTELVRGVTRYIYNREEYARFDSDVGVYRAV
FT                   TPLGRLDAEYWNSQKDILEEDRASVDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEAL
FT                   NHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSAPLIRNGDWTFQILVMLEMTPQRG
FT                   DVYTCHVEHPSLQNPIIVEW"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*04:01:01Variant"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..652
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*04:01:01Variant"
FT                   /number=3
XX
SQ   Sequence 652 BP; 122 A; 161 C; 167 G; 102 T; 100 other;
     aggatttcgt gttccagttt aagggcatgt gctacttcac caacgggacc gagctcgtgc        60
     ggggtgtgac cagatacatc tataaccgag aggagtacgc gcgcttcgac agcgacgtgg       120
     gggtgtatcg ggcggtgacg ccgctggggc ggcttgacgc cgagtactgg aatagccaga       180
     aggacatcct ggaggaggac cgggcgtcgg tggacaccgt atgcagacac aactaccagt       240
     tggagctccg cacgaccttg cagcggcgag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tggagcccac agtgaccatc tccccatcca ggacagaggc cctcaaccac       420
     cacaacctgc tggtctgctc agtgacagat ttctatccag cccagatcaa agtccggtgg       480
     tttcggaatg accaggagga gacaactggc gttgtgtccg ccccccttat taggaacggt       540
     gactggacct tccagatcct ggtgatgctg gaaatgactc cccagcgtgg agacgtctac       600
     acctgccacg tggagcaccc cagcctccag aaccccatca tcgtggagtg gc               652
//