spacer

EBI Dbfetch

ID   HQ267234; SV 1; linear; genomic DNA; STD; HUM; 3332 BP.
XX
AC   HQ267234;
XX
DT   23-MAR-2011 (Rel. 108, Created)
DT   23-MAR-2011 (Rel. 108, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B59) gene, HLA-B59:01:01:02 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3332
RA   Zhu F., He Y.;
RT   "Full length genomic sequence of HLA-B59:01:01:02";
RL   Unpublished.
XX
RN   [2]
RP   1-3332
RA   Zhu F., He Y.;
RT   ;
RL   Submitted (18-SEP-2010) to the INSDC.
RL   HLA Laboratory, Transfusion Institute, Blood Center of Zhejiang Province,
RL   Wulin Road 345, Hangzhou, Zhejiang 310006, China
XX
DR   MD5; c4602c638fb61927261e08d529f2898f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3332
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <285..>2972
FT                   /gene="HLA-B59"
FT                   /allele="HLA-B59:01:01:02"
FT   mRNA            join(<285..357,486..755,1001..1276,1852..2127,2232..2348,
FT                   2790..2822,2929..>2972)
FT                   /gene="HLA-B59"
FT                   /allele="HLA-B59:01:01:02"
FT                   /product="MHC class I antigen"
FT   CDS             join(285..357,486..755,1001..1276,1852..2127,2232..2348,
FT                   2790..2822,2929..2972)
FT                   /codon_start=1
FT                   /gene="HLA-B59"
FT                   /allele="HLA-B59:01:01:02"
FT                   /product="MHC class I antigen"
FT                   /note="HLA-B antigen"
FT                   /db_xref="GOA:C6K6I9"
FT                   /db_xref="IMGT/HLA:B*59:01:01:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C6K6I9"
FT                   /protein_id="ADZ73425.1"
FT                   /translation="MRVTAPRTLLLLLWGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRI
FT                   ALRYYNQSEAGSHTWQTMYGCDLGPDGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
XX
SQ   Sequence 3332 BP; 619 A; 965 C; 1048 G; 700 T; 0 other;
     gatcaggacg aagtcccatg tcccggacgg ggctctcagg gtctcaggct ccgagggccg        60
     cgtctgcatt ggggaggcgc agcgttgggg attccccact cccacgagtt tcacttcttc       120
     tcccaaccta tgtcgggtcc ttcttccagg atactcgtga cgcgtcccca tttcccactc       180
     ccattgggtg tcgggtgtct agagaagcca atcagtgtcg ccggggtccc agttctaaag       240
     tccccacgca cccacccgga ctcagagtct cctcagacac cgagatgcgg gtcacggcac       300
     cccgaaccct cctcctgctg ctctgggggg ccctggccct gaccgagacc tgggccggtg       360
     agtgcgggtc gggagggaaa tggcctctgt ggggaggagc gaggggaccg caggcggggg       420
     cgcaggaccc ggggagccgc gccgggagga gggtctggcg ggtctcagcc cctcctcgcc       480
     cccaggctcc cactccatga ggtatttcta caccgccatg tcccggcccg gccgcgggga       540
     gccccgcttc atcgcagtgg gctacgtgga cgacacgcag ttcgtgaggt tcgacagcga       600
     cgccgcgagt ccgagagagg agccgcgggc gccgtggata gagcaggagg ggccggagta       660
     ttgggaccgg aacacacaga tcttcaagac caacacacag acttaccgag agaacctgcg       720
     gatcgcgctc cgctactaca accagagcga ggccggtgag tgaccccggc ccggggcgca       780
     ggtcacgact ccccatcccc cacgtacggc ccgggtcgcc ccgagtctcc gggtccgaga       840
     tccgcctccc tgaggccgcg ggacccgccc agaccctcga ccggcgagag ccccaggcgc       900
     gtttacccgg tttcattttc agttgaggcc aaaatccccg cgggttggtc ggggcggggc       960
     ggggctcggg ggacggggct gaccgcgggg ccggggccag ggtctcacac ttggcagacg      1020
     atgtatggct gcgacctggg gccggacggg cgcctcctcc gcgggcataa ccagttagcc      1080
     tacgacggca aggattacat cgccctgaac gaggacctga gctcctggac cgcggcggac      1140
     accgcggctc agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcagctgaga      1200
     gcctacctgg agggcacgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag      1260
     acgctgcagc gcgcgggtac caggggcagt ggggagcctt ccccatctcc tataggtcgc      1320
     cggggatggc ctcccacgag aagaggagga aaatgggatc agcgctagaa tgtcgccctc      1380
     ccttgaatgg agaatggcat gagttttcct gagtttcctc tgagggcccc ctcttctctc      1440
     taggacaatt aagggatgac gtctctgagg aaatggaggg gaagacagtc cctagaatac      1500
     tgatcagggg tcctctttga cccctgcagc agccttggga accgtgactt ttcctctcag      1560
     gccttgttct ctgcctcaca ctcagtgtgt ttggggctct gattccagca cttctgagtc      1620
     actttacctc cactcagatc aggagcagaa gtccctgttc cccgctcaga gactcgaact      1680
     ttccaatgaa taggagatta tcccaggtgc ctgcgtccag gctggtgtct gggttctgtg      1740
     ccccttcccc accccaggtg tcctgtccat tctcaggctg gtcacatggg tggtcctagg      1800
     gtgtcctatg agagatgcaa agcgcctgaa ttttctgact cttcccatca gaccccccaa      1860
     agacacacgt gacccaccac cccatctctg accatgaggc caccctgagg tgctgggccc      1920
     tgggcttcta ccctgcggag atcacactga cctggcagcg ggatggcgag gaccaaactc      1980
     aggacactga gcttgtggag accagaccag caggagatag aaccttccag aagtgggcag      2040
     ctgtggtggt gccttctgga gaagagcaga gatacacatg ccatgtacag catgaggggc      2100
     tgccgaagcc cctcaccctg agatggggta aggaggggga tgaggggtca tatctcttct      2160
     cagggaaagc aggagccctt ctggagccct tcagcagggt cagggcccct cgtcttcccc      2220
     tcctttccca gagccatctt cccagtccac catccccatc gtgggcattg ttgctggcct      2280
     ggctgtccta gcagttgtgg tcatcggagc tgtggtcgct actgtgatgt gtaggaggaa      2340
     gagctcaggt agggaagggg tgaggggtgg ggtctgggtt ttcttgtccc actgggggtt      2400
     tcaagcccca ggtagaagtg ttccctgcct cattactggg aagcagcatc cacacagggg      2460
     ctaatgcagc ctgggaccct gtgtgccagc acttactctt ttgtgcagca catgtgacaa      2520
     tgaaggacgg atgtatcacc ttgatggttg tggtgttggg gtcctgattt cagcattcat      2580
     gagtcagggg aaggtccctg ctaaggacag accttaggag ggcagttggt ccaggaccca      2640
     cacttgcttt cctcgtgttt cctgatcctg ccttgggtct gtagtcatac ttctggaaat      2700
     tccttttggg tccaagacga ggaggttcct ctaagatctc atggccctgc ttcctcccag      2760
     tcccctcaca ggacattttc ttcccacagg tggaaaagga gggagctact ctcaggctgc      2820
     gtgtaagtgg tgggggtggg agtgtggagg agctcaccca ccccataatt cctcctgtcc      2880
     cacgtctcct gcgggctctg accaggtcct gtttttgttc tactccagcc agcgacagtg      2940
     cccagggctc tgatgtgtct ctcacagctt gaaaaggtga gattcttggg gtctagagtg      3000
     ggcggggggg ggtggggtgg ggagggggca gaggggaaag gcctgggtaa tggagattct      3060
     ttgattggga tgttacgcgt gtgtggtggg ctgtttagag tgtcatcact taccatgact      3120
     aaccagaatt tgttcatgac tgttgttttc tgtagcctga gacagctgtc ttgtgaggga      3180
     ctgagatgca ggatttcttc actcctcccc tttgtgactt caagagcctc tggcatctct      3240
     ttctgcaaag gcacctgaat gtgtctgcgt ccctgttagc ataatgtgag gaggtggaga      3300
     gacagcccac ccccgtgtcc actgtgaccc ct                                    3332
//


spacer
spacer