Dbfetch

ID   HQ257218; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   HQ257218;
XX
DT   13-MAR-2011 (Rel. 108, Created)
DT   13-MAR-2011 (Rel. 108, Last updated, Version 1)
XX
DE   Homo sapiens isolate 405/2010 MHC class II antigen (HLA-DQB1) gene,
DE   HLA-DQB1*02 variant allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Smillie D., Darke C.;
RT   "Identification of a new HLA-DQB1 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Smillie D., Darke C.;
RT   ;
RL   Submitted (13-SEP-2010) to the INSDC.
RL   Histocompatibility Laboratory, NHS Blood & Transplant, Longley Lane,
RL   Sheffield, South Yorkshire S5 7JN, UK
XX
DR   MD5; 115cfa60830aaaf9d612b2f8071fcab4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /isolate="405/2010"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*02 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*02 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*02 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:F1CGQ1"
FT                   /db_xref="IMGT/HLA:DQB1*02:01:04"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:F1CGQ1"
FT                   /protein_id="ADZ24220.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAV
FT                   TLLGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRR"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*02 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 62 A; 67 C; 95 G; 46 T; 0 other;
     aggatttcgt gtaccagttt aagggcatgt gctacttcac caacgggaca gagcgcgtgc        60
     gtcttgtgag cagaagcatc tataaccgag aagagatcgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg ctgctggggc tgcctgccgc cgagtactgg aacagccaga       180
     aggacatcct ggaaaggaaa cgggcggcgg tggacagggt gtgcagacac aactaccagt       240
     tggagctccg cacgaccttg cagcggcgag                                        270
//