spacer

EBI Dbfetch

ID   HQ215835; SV 1; linear; genomic DNA; STD; HUM; 1669 BP.
XX
AC   HQ215835;
XX
DT   20-FEB-2011 (Rel. 107, Created)
DT   20-FEB-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Homo sapiens isolate CS00039 MHC class I antigen (HLA-C) gene, HLA-C*080201
DE   variant allele, exons 2 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1669
RA   Cao K., Rowlands J., Lau M., Layne N., Naim M., Reinsmoen N.L.;
RT   "New sequences of C*080201 variant";
RL   Unpublished.
XX
RN   [2]
RP   1-1669
RA   Cao K., Rowlands J., Lau M., Layne N., Naim M., Reinsmoen N.L.;
RT   ;
RL   Submitted (02-SEP-2010) to the INSDC.
RL   HLA Laboratory, Comprehensive Transplant Center, Department of Medicine,
RL   Cedars-Sinai Medical Center, 8723 Alden Dr. SSB 197, Los Angeles, CA 90048,
RL   USA
XX
DR   MD5; 11b1c76f4ca99ed81cdecf3fb653b006.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1669
FT                   /organism="Homo sapiens"
FT                   /isolate="CS00039"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1669
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*080201 variant"
FT   mRNA            join(<1..270,517..792,1394..>1669)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*080201 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,517..792,1394..>1669)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*080201 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:F1C8N6"
FT                   /db_xref="IMGT/HLA:C*08:43"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:F1C8N6"
FT                   /protein_id="ADX42719.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADKAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRCLENGKKTLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*080201 variant"
FT                   /number=2
FT   gap             271..516
FT                   /estimated_length=246
FT   exon            517..792
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*080201 variant"
FT                   /number=3
FT   gap             793..1393
FT                   /estimated_length=601
FT   exon            1394..1669
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*080201 variant"
FT                   /number=4
XX
SQ   Sequence 1669 BP; 174 A; 252 C; 285 G; 111 T; 847 other;
     gctcccactc catgaggtat ttctacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcagttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnggtc tcacaccctc cagaggatgt       540
     atggctgcga cctggggccc gacgggcgcc tcctccgcgg gtataaccag ttcgcctacg       600
     acggcaagga ttacatcgcc ctgaatgagg acctgcgctc ctggaccgcc gcggacaagg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtga ggcggagcag cggagagcct       720
     acctggaggg cacgtgcgtg gagtggctcc gcagatgcct ggagaacggg aagaagacgc       780
     tgcagcgcgc ggnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1380
     nnnnnnnnnn nnnaacaccc aaagacacac gtgacccacc atcccgtctc tgaccatgag      1440
     gccaccctga ggtgctgggc cctgggcttc taccctgcgg agatcacact gacctggcag      1500
     cgggatggcg aggaccaaac tcaggacacc gagcttgtgg agaccaggcc agcaggagat      1560
     ggaaccttcc agaagtgggc agctgtggtg gtgccttctg gagaagagca gagatacacg      1620
     tgccatgtgc agcacgaggg gctgccagag cccctcaccc tgagatggg                  1669
//


spacer
spacer