spacer

EBI Dbfetch

ID   HQ201391; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   HQ201391;
XX
DT   21-FEB-2011 (Rel. 107, Created)
DT   24-OCT-2011 (Rel. 110, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*68xy new allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.1399-0039.2011.01722.x.
RX   PUBMED; 21729008.
RA   Loacker K., Hortnagl P., Grabmer C., Schennach H., Muhlbacher A.;
RT   "A novel HLA-A allele detected by sequence-based typing: A*68:66";
RL   Tissue Antigens 78(5):397-397(2011).
XX
RN   [2]
RP   1-270
RA   Muehlbacher A., Hoertnagl P., Loacker K.;
RT   ;
RL   Submitted (30-AUG-2010) to the INSDC.
RL   Central Institute for Blood Transfusion & Department of Immunology,
RL   University Clinics Regional Hospital Innsbruck, Anichstrasse 35, Innsbruck,
RL   Tyrol 6020, Austria
XX
DR   MD5; a193b5f5147bae73b1ec1afb1b33a1ac.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68xy new"
FT   mRNA            <1..>270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68xy new"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68xy new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:F1C5F3"
FT                   /db_xref="IMGT/HLA:A*68:66"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:F1C5F3"
FT                   /protein_id="ADX86747.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEA"
XX
SQ   Sequence 270 BP; 52 A; 83 C; 97 G; 38 T; 0 other;
     gctcccactc catgaggtat ttctacactt ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer