Dbfetch

ID   HQ168401; SV 1; linear; genomic DNA; STD; HUM; 951 BP.
XX
AC   HQ168401;
XX
DT   29-DEC-2010 (Rel. 107, Created)
DT   29-DEC-2010 (Rel. 107, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-C*15:06var allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-951
RA   Recker K., Fuerst D., Mytilineos J.;
RT   "A new variant of HLA-C*15:06";
RL   Unpublished.
XX
RN   [2]
RP   1-951
RA   Recker K., Fuerst D., Mytilineos J.;
RT   ;
RL   Submitted (20-AUG-2010) to the INSDC.
RL   Transplantation Immunology, IKT Ulm, Helmholtzstrasse 10, Ulm 89081,
RL   Germany
XX
DR   MD5; c4a24bd32b505f023bb9905f99e06cc1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..951
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>951
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*15:06var"
FT   mRNA            join(<1..270,676..>951)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*15:06var"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,676..>951)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*15:06var"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:C*15:06:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:E7D849"
FT                   /protein_id="ADU18492.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQNYKRQAQTDRVNLRKLRGYYNQSEAGSHIIQRMYGCDLGP
FT                   DGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   gap             271..675
FT                   /estimated_length=405
XX
SQ   Sequence 951 BP; 111 A; 170 C; 195 G; 70 T; 405 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccggccgc ggagagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaactac aagcgccagg cacagactga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       600
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnggtct cacatcatcc agaggatgta tggctgcgac ctggggcccg       720
     acgggcgcct cctccgcggg catgaccagt acgcctacga cggcaaggat tacatcgccc       780
     tgaacgagga cctgcgctcc tggaccgccg cggacaccgc ggctcagatc acccagcgca       840
     agtgggaggc ggcccgtgag gcggagcagc tgagagccta cctggagggc acgtgcgtgg       900
     agtggctccg cagatacctg gagaacggga aggagacgct gcagcgcgcg g                951
//