Dbfetch

ID   HQ149727; SV 1; linear; genomic DNA; STD; HUM; 1792 BP.
XX
AC   HQ149727;
XX
DT   07-SEP-2010 (Rel. 106, Created)
DT   07-SEP-2010 (Rel. 106, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*03new allele, exons 2
DE   through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1792
RA   Chang Y., Alonzo P., Pascual C.J.;
RT   "A New HLA-A*03 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-1792
RA   Chang Y., Alonzo P., Pascual C.J.;
RT   ;
RL   Submitted (12-AUG-2010) to the INSDC.
RL   Pathology and Laboratory Medicine, All Children's Hospital, 501 6th Avenue
RL   South, St. Petersburg, FL 33701, USA
XX
DR   MD5; 4373113d99ede41d176dd607dee405f8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1792
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1792
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT   mRNA            join(<72..341,583..858,1437..>1712)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<72..341,583..858,1437..>1712)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:A*03:112"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:E1B2D6"
FT                   /protein_id="ADM26765.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGS
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTC
FT                   VEWLRRYLENGKETLQRTDPPKTHMTDHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            72..341
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /number=2
FT   exon            583..858
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /number=3
FT   exon            1437..1712
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /number=4
XX
SQ   Sequence 1792 BP; 340 A; 542 C; 591 G; 319 T; 0 other;
     cgggggcgca ggaccggggg agccgcgccg ggacgagggt cgggcaggtc tcagccactg        60
     ctcgccccca ggctcccact ccatgaggta tttcttcaca tccgtgtccc ggcccggccg       120
     cggggagccc cgcttcatcg ccgtgggcta cgtggacgac acgcagttcg tgcggttcga       180
     cagcgacgcc gcgagccaga ggatggagcc gcgggcgccg tggatagagc aggaggggcc       240
     ggagtattgg gaccaggaga cacggaatgt gaaggcccag tcacagactg accgagtgga       300
     cctggggacc ctgcgcggct actacaacca gagcgaggcc ggtgagtgac cccggccggg       360
     ggcgcaggtc aggacccctc atcccccacg gacgggccag gtcgcccaca gtctccgggt       420
     ccgagatcca ccccgaagcc gcgggacccc gagacccttg ccccgggaga ggcccaggcg       480
     cctttacccg gtttcatttt cagtttaggc caaaaatccc cccgggttgg tcggggctgg       540
     gcggggctcg ggggactggg ctgaccgcgg ggtcggggcc aggttctcac accatccaga       600
     taatgtatgg ctgcgacgtg gggtcggacg ggcgcttcct ccgcgggtac cggcaggacg       660
     cctacgacgg caaggattac atcgccctga acgaggacct gcgctcttgg accgcggcgg       720
     acatggcggc tcagatcacc aagcgcaagt gggaggcggc ccatgaggcg gagcagttga       780
     gagcctacct ggatggcacg tgcgtggagt ggctccgcag atacctggag aacgggaagg       840
     agacgctgca gcgcacgggt accaggggcc acggggcgcc tccctgatcg cctgtagatc       900
     tcccgggctg gcctcccaca aggaggggag acaattggga ccaacactag aatatcaccc       960
     tccctctggt cctgagggag aggaatcctc ctgggttcca gatcctgtac cagagagtga      1020
     ctctgaggtt ccgccctgct ctctgacaca attaagggat aaaatctctg aaggagtgac      1080
     gggaagacga tccctcgaat actgatgagt ggttcccttt gacaccggca gcagccttgg      1140
     gcccgtgact tttcctctca ggccttgttc tctgcttcac actcaatgtg tgtgggggtc      1200
     tgagtccagc acttctgagt ccctcagcct ccactcaggt caggaccaga agtcgctgtt      1260
     cccttctcag ggaatagaag attatcccag gtgcctgtgt ccaggctggt gtctgggttc      1320
     tgtgctctct tccccatccc gggtgtcctg tccattctca agatggccac atgcgtgctg      1380
     gtggagtgtc ccatgacaga tgcaaaatgc ctgaattttc tgactcttcc cgtcagaccc      1440
     ccccaagaca catatgaccg accaccccat ctctgaccat gaggccaccc tgaggtgctg      1500
     ggccctgggc ttctaccctg cggagatcac actgacctgg cagcgggatg gggaggacca      1560
     gacccaggac acggagctcg tggagaccag gcctgcaggg gatggaacct tccagaagtg      1620
     ggcggctgtg gtggtgcctt ctggagagga gcagagatac acctgccatg tgcagcatga      1680
     gggtctgccc aagcccctca ccctgagatg gggtaaggag ggagatgggg gtgtcatgtc      1740
     tcttagggaa agcaggagcc tctctggaga cctttagcag ggtcagggcc cc              1792
//