spacer

EBI Dbfetch

ID   HQ012374; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   HQ012374;
XX
DT   31-JAN-2011 (Rel. 107, Created)
DT   31-JAN-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Homo sapiens isolate CS00035 MHC class II antigen (HLA-DRB1) gene,
DE   HLA-DRB1*160201v allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Wang Q., Cao K., Semendyayeva M., Naim M., Lai C.-H., Ong G.,
RA   Reinsmoen N.L.;
RT   "Novel sequences of DRB1*160201v";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Wang Q., Cao K., Semendyayeva M., Naim M., Lai C.-H., Ong G.,
RA   Reinsmoen N.L.;
RT   ;
RL   Submitted (03-AUG-2010) to the INSDC.
RL   HLA Laboratory, Comprehensive Transplant Center, Cedars-Sinai Medical
RL   Center, 8723 Alden Dr. SSB 197, Los Angeles, CA 90048, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /isolate="CS00035"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*160201v"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*160201v"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*160201v"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:E9LIR7"
FT                   /db_xref="IMGT/HLA:DRB1*16:17"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:E9LIR7"
FT                   /protein_id="ADU78720.1"
FT                   /translation="RFLWQPKRECNFFNGTERVRFLDRYFYNQEESVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEDRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*160201v"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 66 C; 99 G; 47 T; 0 other;
     cacgtttcct gtggcagcct aagagggagt gtaatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacctcct ggaagacagg cgcgccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer