spacer

EBI Dbfetch

ID   HM998989; SV 1; linear; genomic DNA; STD; HUM; 3768 BP.
XX
AC   HM998989;
XX
DT   29-DEC-2010 (Rel. 107, Created)
DT   29-DEC-2010 (Rel. 107, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1*03:03 variant
DE   allele, exons 2 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3768
RA   Serov Y.A., Hommel-Berrey G.A., House K.D., Arnoff T.S., Lobashevsky A.L.;
RT   "Discovery of the new HLA-DQB1*03xx allele in caucasian family";
RL   Unpublished.
XX
RN   [2]
RP   1-3768
RA   Serov Y.A., Hommel-Berrey G.A., House K.D., Arnoff T.S., Lobashevsky A.L.;
RT   ;
RL   Submitted (30-JUL-2010) to the INSDC.
RL   Medicine, Indiana University (IUPUI), Riley Hospital, Room 0615, 702
RL   Barnhill Drive, Indianapolis, IN 46202, USA
XX
DR   MD5; 243deb6b553089a82e76efe711a2a8c0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3768
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>3768
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:03 variant"
FT   mRNA            join(<106..375,2906..3186,3705..>3768)
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:03 variant"
FT                   /product="MHC class II antigen"
FT   CDS             join(<106..375,2906..3186,3705..>3768)
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:03 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:E7D0K1"
FT                   /db_xref="IMGT/HLA:DQB1*03:31"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:E7D0K1"
FT                   /protein_id="ADU03770.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAV
FT                   TPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEAL
FT                   NHHNLLICSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQRG
FT                   DVYTCHVEHPSLQNPIIVEWAQSESAQSKMLSGIGGFVLGL"
FT   exon            106..375
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:03 variant"
FT                   /number=2
FT   exon            2906..3186
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:03 variant"
FT                   /number=3
FT   exon            3705..>3768
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:03 variant"
FT                   /number=4
XX
SQ   Sequence 3768 BP; 968 A; 875 C; 881 G; 1044 T; 0 other;
     cgcgggctgt tccacagctc cgggccgggt cagggcggcg gctgcggggg cggccgggct        60
     ggggccgggc cggggcctga ctgaccggcc ggtggttccc cgcagaggat ttcgtgtacc       120
     agtttaaggg catgtgctac ttcaccaacg ggacggagcg cgtgcgtctt gtgaccagat       180
     acatctataa ccgagaggag tacgcacgct tcgacagcga cgtgggggtg tatcgggcgg       240
     tgacgccgct ggggccgcct gacgccgagt actggaacag ccagaaggaa gtcctggaga       300
     ggacccgggc ggagttggac acggtgtgca gacacaacta ccagttggag ctccgcacga       360
     ccttgcagcg gcgaggtgag cgtcgtcgcc cgtctgcgag gcccatcctt ggcaggggcc       420
     cagagtctct gcgccaggag gggcgaaggg ggcgcggcct ctggaacctg agccttgttc       480
     gttccacccc ggctgacagg aggaggcggt gggggtgctg ggggctggtg catcggaggg       540
     gcagggacct agggcagagc agggggacag gcagagttgg tcaagctgcc tagtttcgcc       600
     ccatcctccc cgtccgtcgg cctcgccctc tgctctgcac gttcttgcct cgtgccttat       660
     gcgtttgcct cctcgtgcct tacctttact aagcagttct ctctgccccc aatttccgcc       720
     ctcttcccct gcccgcccgc ccggctagca ctgccgcacc cggcaaggtc cacctacaca       780
     gctcatgcag tgggaagctt cagacttggc ctgatggagt tagggctgcc ccacaactgc       840
     gcgcagggca tccagcaatt acagttgtca aataagatat tttgactttt gacttcaaat       900
     tattattcat cgtaattctg ttttcttaaa tggctctcat tcatggcgga gctctttgag       960
     atgagagtgt tttaatcatt gcatgcctgg tatctgacac attgactggc atgtggtatg      1020
     agctcaatga tcttctgtta aattaatgaa taaatgtgct cagctgccaa tccacttagg      1080
     ctcaagggaa agcagaggat aaatagagcc ttaaaaatgg acttttatta attattttct      1140
     gtcattttgc ttaattcttt aaagtaaact cttattgact tggatcttaa tagagtttgt      1200
     gaatacaaag tctgaggaaa aaagtgtttg ctaaaaataa aaacaacact tgaatgatgt      1260
     ttgtaaggca gttttaattt cttagaaaag ctgaacaaat ggcacaatgc aaagagcaga      1320
     agttttggaa taaatagatt gaagcaatta aattattgga taaaaatagt ttcaggttgc      1380
     ttttggctta ggttctcccc tccccccatc actatccact tcaggaataa acattctgaa      1440
     agtcaatttt acccatttag tgagcactta tttctagaca gttaccttat caaataccgt      1500
     ctatgttacg tcatttaatc tcacagttgc ctgtgcatta gagattagca tcaccacttt      1560
     atatatccta atattagtac atgacaaaca ctttaagtaa tcagcccaca agtactcacc      1620
     aagaccttaa gcctcccaaa gtacacaata ttctttatgt tcttcactac acatctatag      1680
     agtcaaaggg acataaagcc ttgttaaagc cagttttgac tagaagcagc aatgagtctc      1740
     ttcctgtttg atctccatgt taatgggaca aaatgatact ttcaaggcat tgaaaattta      1800
     tgattaatca atccctagtc tgactccagt gttacctatg cagattcaca aaacttttag      1860
     tttactttaa actcccttgc cttcttttga ctcacatcgt agtgccagca agtacttaca      1920
     tttttgctat tttggttcta tttccataaa atttatttta tcatcttttc tcataagttt      1980
     gtgccctcta ttttactccc agtctgtgta agatgaacaa atcttataag gccacatagc      2040
     tgactgtgat ttcaggtgga ctccaggaag gagaaccaaa gaaaagttca agtccaagca      2100
     gaaaccgtga ttccttccgg atgatggctc aagagtgcct tttaattggg gtgcaacctg      2160
     ctgacctcag caaatctcag ctatatttat atgttcacat tacaggctca ttaacctagg      2220
     ctgatctctg caaggatctc agaatatttt ctacagataa catacatgat aatatctgat      2280
     ttcaggacaa aaaagtaatt ctcaatagca agggaatgga gtagggtaga cagctagtaa      2340
     ttaaactcac ttgtatgtta aaaataaatt aaggaaaaaa agaaaatgag agaacatatt      2400
     actaaataaa gaaagcatac attaaatatt tactatagtt tcacactaag agaataaagg      2460
     aaatgcaata aagtggcctg aaagataaag gatgagacgt gtaaagagac agggaaagat      2520
     gtgtcatttt tttactatga gcagcagtct gagaagataa aggaatcgag ttatgggcaa      2580
     acatgatgtt tgatcagtgt tatttgtttt gaaggcctgc ctacttttgt ttcaaatatt      2640
     acagactttt gaaatcacat tctttttgtt ttttgctgtc tgttactaga tcgcacattc      2700
     tgtaaaggca gggaccatgg tatgttgttt atctttggat tctcagtgat tgtcatattt      2760
     atatttgttg aatgaatctt aatccaagac ttggactcca ggtatctttc cactctggtt      2820
     ccaaggaggg accattccca atggtagacg tgctgtgtgg tctcacatct cactcctgtc      2880
     ttttcctgtc tgttactgcc ctcagtggag cccacagtga ccatctcccc atccaggaca      2940
     gaggccctca accaccacaa cctgctgatc tgctcagtga cagatttcta tccagcccag      3000
     atcaaagtcc ggtggtttcg gaatgaccag gaggagacaa ctggcgttgt gtccaccccc      3060
     cttattagga acggtgactg gaccttccag atcctggtga tgctggaaat gactccccag      3120
     cgtggagacg tctacacctg ccacgtggag caccccagcc tccagaaccc catcatcgtg      3180
     gagtggcgta aggggatatt gagtttctgt tactatgggc cccacaagac aaagggcaga      3240
     gctccttctg acccattcct tcccatctct tatccctgat gtcactactg agctggggat      3300
     cacaggagac tagagcacct cttgctccat ggcaagtgca tcagaagaat cctgatctca      3360
     tcacctttcc agatgctagg gaaattattc tacgtactgt ttctccagat cccagtcctg      3420
     atagctcgga gggacttatt attagggctg gtgactggga tcttagggtt taaggtatgg      3480
     atgagttcct gaggagtgga gatctgcttc cccgctctct cacctactca ctgtaccgaa      3540
     ggacctattg gctggctttc ccctccctta ggggtggtct gaatggagga ctaggttcct      3600
     ttgacacttt cacctcctgc atctcagact ggacttcagc tcctcagcag ggatgctatg      3660
     gggtgtaggg acaaacactg acactcaggc tctgcttctt aggggctcag tctgaatctg      3720
     cccagagcaa gatgctgagt ggcattggag gcttcgtgct ggggctga                   3768
//


spacer
spacer