spacer

EBI Dbfetch

ID   HM997021; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   HM997021;
XX
DT   03-OCT-2010 (Rel. 106, Created)
DT   24-OCT-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1*02:01:03
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.1399-0039.2011.01650.x.
RX   PUBMED; 21395562.
RA   Lee K.W.;
RT   "Two novel HLA class II alleles, DRB1*11:96 and DQB1*02:01:03, identified
RT   in Koreans";
RL   Tissue Antigens 77(6):601-602(2011).
XX
RN   [2]
RP   1-270
RA   Lee K.W.;
RT   ;
RL   Submitted (28-JUL-2010) to the INSDC.
RL   Hallym Institute for Genome Application, Hallym University, 896
RL   Pyungchon-Dong, Dongan-Gu, Anyang, Kyungki-Do 431-070, Korea
XX
DR   MD5; af72e485f501169e59bc6df3c425b289.
DR   Ensembl-Gn; ENSG00000206237; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206302; homo_sapiens.
DR   Ensembl-Gn; ENSG00000225824; homo_sapiens.
DR   Ensembl-Tr; ENST00000383121; homo_sapiens.
DR   Ensembl-Tr; ENST00000383247; homo_sapiens.
DR   Ensembl-Tr; ENST00000399670; homo_sapiens.
DR   Ensembl-Tr; ENST00000415926; homo_sapiens.
DR   Ensembl-Tr; ENST00000419914; homo_sapiens.
DR   Ensembl-Tr; ENST00000421888; homo_sapiens.
DR   Ensembl-Tr; ENST00000424806; homo_sapiens.
DR   Ensembl-Tr; ENST00000473366; homo_sapiens.
DR   Ensembl-Tr; ENST00000547498; homo_sapiens.
DR   Ensembl-Tr; ENST00000548953; homo_sapiens.
DR   Ensembl-Tr; ENST00000551970; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*02:01:03"
FT   mRNA            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*02:01:03"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*02:01:03"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:E2J6N1"
FT                   /db_xref="IMGT/HLA:DQB1*02:01:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:E2J6N1"
FT                   /protein_id="ADN88900.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAV
FT                   TLLGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRR"
FT   exon            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*02:01:03"
FT                   /number=2
XX
SQ   Sequence 270 BP; 62 A; 67 C; 95 G; 46 T; 0 other;
     aggatttcgt gtaccagttt aagggcatgt gctacttcac caacgggaca gagcgcgtgc        60
     gtcttgtgag cagaagcatc tataaccgag aagagatcgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcagtgacg ctgctggggc tgcctgccgc cgagtactgg aacagccaga       180
     aggacatcct ggagaggaaa cgggcggcgg tggacagggt gtgcagacac aactaccagt       240
     tggagctccg cacgaccttg cagcggcgag                                        270
//


spacer
spacer