spacer

EBI Dbfetch

ID   HM989018; SV 1; linear; mRNA; STD; HUM; 546 BP.
XX
AC   HM989018;
XX
DT   23-DEC-2010 (Rel. 107, Created)
DT   01-MAY-2014 (Rel. 120, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) mRNA, HLA-B*55 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RA   Li J.-P., Chen Y.;
RT   "A novel HLA-B*07 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-546
RA   Li J.-P., Chen Y.;
RT   ;
RL   Submitted (25-JUL-2010) to the INSDC.
RL   HLA Lab, Liaoning Blood Center, Beihai Street Dadong District, Shenyang,
RL   Liaoning 110044, China
XX
DR   MD5; 22e4557f9d9e3497823d2d349367273a.
DR   H-InvDB; HIT000651182_02.2.
DR   H-InvDB; HIT000651182_03.2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>546
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55 variant"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:E7CZN3"
FT                   /db_xref="H-InvDB:HIT000651182_01.2"
FT                   /db_xref="IMGT/HLA:B*55:46"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:E7CZN3"
FT                   /protein_id="ADT80735.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTWQTMYGCDLGP
FT                   DGRLLRGHDQLAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
XX
SQ   Sequence 546 BP; 111 A; 168 C; 196 G; 71 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacac ttggcagacg atgtatggct       300
     gcgacctggg gccggacggg cgcctcctcc gcgggcatga ccagttagcc tacgacggca       360
     aggattacat cgccctgaac gaggacctga gctcctggac cgcggcggac accgcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcagctgaga gcctacctgg       480
     agggcacgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcgcgg                                                                  546
//


spacer
spacer