Dbfetch

ID   HM856618; SV 1; linear; genomic DNA; STD; HUM; 1443 BP.
XX
AC   HM856618;
XX
DT   20-FEB-2011 (Rel. 107, Created)
DT   24-OCT-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Homo sapiens clone P2084 MHC class I polypeptide-related protein A (MICA)
DE   gene, exons 2 through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1443
RX   DOI; 10.1111/j.1399-0039.2011.01639.x.
RX   PUBMED; 21388367.
RA   Tan Y., Ye X., Xu X.Z., Xia W., Fu Y.S., Huang Y.F.;
RT   "MICA*002:04: a new allele identified by sequence-based typing in a Chinese
RT   individual";
RL   Tissue Antigens 78(1):74-76(2011).
XX
RN   [2]
RP   1-1443
RA   Huang Y., Xu X., Ding H., Ye X., Zou Y., Stastny P., Xia W., Fu Y.,
RA   Rong X., Luo G.;
RT   ;
RL   Submitted (26-JUL-2010) to the INSDC.
RL   Abdominal Surgery, Guangzhou First Municipal People's Hospital, No.1 Panfu
RL   Road, Guangzhou, Guangdong 510180, China
XX
DR   MD5; 9241df1654ffe95926079948bbfc99dc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1443
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="P2084"
FT                   /note="PCR_primers=fwd_name: MICA6823-1F, rev_name:
FT                   MICA9023-4R"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1443
FT                   /gene="MICA"
FT   mRNA            join(<1..255,530..817,918..1196,1297..>1443)
FT                   /gene="MICA"
FT                   /product="MHC class I polypeptide-related protein A"
FT   CDS             join(<1..255,530..817,918..1196,1297..>1443)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /product="MHC class I polypeptide-related protein A"
FT                   /db_xref="GOA:F1BE19"
FT                   /db_xref="IMGT/HLA:MICA*002:04"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:F1BE19"
FT                   /protein_id="ADX53323.1"
FT                   /translation="PHSLRYNLTVLSGDGSVQSGFLAEVHLDGQPFLRCDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQS
FT                   HWQTFHVSAVAAAAAAAAAIFVIIIFYVCCCKKKTSAAEGP"
FT   exon            <1..255
FT                   /gene="MICA"
FT                   /number=2
FT   exon            530..817
FT                   /gene="MICA"
FT                   /number=3
FT   gap             818..917
FT                   /estimated_length=unknown
FT   exon            918..1196
FT                   /gene="MICA"
FT                   /number=4
FT   exon            1297..>1443
FT                   /gene="MICA"
FT                   /number=5
XX
SQ   Sequence 1443 BP; 322 A; 321 C; 423 G; 277 T; 100 other;
     agccccacag tcttcgttat aacctcacgg tgctgtccgg ggatggatct gtgcagtcag        60
     ggtttctcgc tgaggtacat ctggatggtc agcccttcct gcgctgtgac aggcagaaat       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggaaataag acatgggaca       180
     gagagaccag ggacttgaca gggaacggaa aggacctcag gatgaccctg gctcatatca       240
     aggaccagaa agaaggtgag agtcggcagg ggcaagagtg actggagagg ccttttccag       300
     aaaagttagg ggcagagagc agggacctgt atctacccac tggatctggc tcaggctggg       360
     ggtgaggaat gggggtcagt ggaactcagc agggaggtga gccggcactc agcccacaca       420
     gggaggcatg gaggagggcc agggaggcgt accccctggg ctgagttcct cacttgggtg       480
     gaaaggtgat gggttcggga atggagaagt cactgctggg tgggggcagg cttgcattcc       540
     ctccaggaga ttagggtctg tgagatccat gaagacaaca gcaccaggag ctcccagcat       600
     ttctactacg atggggagct cttcctctcc caaaacctgg agactgagga atggacaatg       660
     ccccagtcct ccagagctca gaccttggca atgaacgtca ggaatttctt gaaggaagat       720
     gccatgaaga ccaagacaca ctatcacgct atgcatgcag actgcctgca ggaactacgg       780
     cgatatctaa aatccggcgt agtcctgagg agaacagnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnntgc cccccatggt gaatgtcacc cgcagcgagg cctcagaggg       960
     caacattacc gtgacatgca gggcttctgg cttctatccc tggaatatca cactgagctg      1020
     gcgtcaggat ggggtatctt tgagccacga cacccagcag tggggggatg tcctgcctga      1080
     tgggaatgga acctaccaga cctgggtggc caccaggatt tgccaaggag aggagcagag      1140
     gttcacctgc tacatggaac acagcgggaa tcacagcact caccctgtgc cctctggtga      1200
     gcctagggtg accctggaga gggtcaggcc agggtaggga cagcagggat ggctgtggct      1260
     ctctgcccag tgtataacaa gtcccttttt tttcagggaa agtgctggtg cttcagagtc      1320
     attggcagac attccatgtt tctgctgttg ctgctgctgc tgctgctgct gctgctattt      1380
     ttgttattat tattttctac gtctgttgtt gtaagaagaa aacatcagct gcagagggtc      1440
     cag                                                                    1443
//