Dbfetch

ID   HM777039; SV 1; linear; genomic DNA; STD; HUM; 888 BP.
XX
AC   HM777039;
XX
DT   03-OCT-2010 (Rel. 106, Created)
DT   03-OCT-2010 (Rel. 106, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*50variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-888
RA   Zhang J., Xie W., Miao F., Sun H., Pan N.;
RT   ;
RL   Submitted (19-JUL-2010) to the INSDC.
RL   Key Laboratory of Developmental Genes and Human Disease, Southeast
RL   University Medical School, No. 87 DingJiaQiao Road, Nanjing, Jiangsu
RL   210009, China
XX
DR   MD5; 6f2e9266c34925fe359c0bdaf268e4ad.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..888
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>888
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*50variant"
FT   mRNA            join(<75..344,590..>865)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*50variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<75..344,590..>865)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*50variant"
FT                   /product="MHC class I antigen"
FT                   /note="HLA class I antigen"
FT                   /db_xref="GOA:E2J423"
FT                   /db_xref="IMGT/HLA:B*55:49"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:E2J423"
FT                   /protein_id="ADN93294.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRVSLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            75..344
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*50variant"
FT                   /number=2
FT   exon            590..865
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*50variant"
FT                   /number=3
XX
SQ   Sequence 888 BP; 152 A; 297 C; 328 G; 111 T; 0 other;
     aggcgggggc gcaggacccg gggagccgcg ccgggaggag ggtctggcgg gtctcagccc        60
     ctcctcgccc ccaggctccc actccatgag gtatttctac accgccatgt cccggcccgg       120
     ccgcggggag ccccgcttca tcgcagtggg ctacgtggac gacacgcagt tcgtgaggtt       180
     cgacagcgac gccgcgagtc cgagagagga gccgcgggcg ccgtggatag agcaggaggg       240
     gccggagtat tgggaccgga acacacagat ctacaaggcc caggcacaga ctgaccgagt       300
     gagcctgcgg aacctgcgcg gctactacaa ccagagcgag gccggtgagt gaccccggcc       360
     cggggcgcag gtcacgactc cccatccccc acgtacggcc cgggtcgccc cgagtctccg       420
     ggtccgagat ccgcctccct gaggccgcgg gacccgccca gaccctcgac cggcgagagc       480
     cccaggcgcg tttacccggt ttcattttca gttgaggcca aaatccccgc gggttggtcg       540
     gggcggggcg gggctcgggg gactgggctg accgcggggc cggggccagg gtctcacacc       600
     ctccagagca tgtacggctg cgacgtgggg ccggacgggc gcctcctccg cgggcataac       660
     cagtacgcct acgacggcaa ggattacatc gccctgaacg aggacctgcg ctcctggacc       720
     gccgcggaca ccgcggctca gatcacccag cgcaagtggg aggcggcccg tgtggcggag       780
     cagctgagag cctacctgga gggcacgtgc gtggagtggc tccgcagata cctggagaac       840
     gggaaggaga cgctgcagcg cgcgggtacc aggggcagtg gggagcct                    888
//