spacer

EBI Dbfetch

ID   HM768894; SV 1; linear; genomic DNA; STD; HUM; 267 BP.
XX
AC   HM768894;
XX
DT   30-NOV-2010 (Rel. 107, Created)
DT   30-NOV-2010 (Rel. 107, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*1119 allele, exon 2
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-267
RA   Jiao L.X., Ju R.Q., Han Y., Yang F., Lin Q.F., Yu J.H.;
RT   "A HLA-A*1119 variant sequence";
RL   Unpublished.
XX
RN   [2]
RP   1-267
RA   Jiao L.X., Ju R.Q., Han Y., Yang F., Lin Q.F., Yu J.H.;
RT   ;
RL   Submitted (14-JUL-2010) to the INSDC.
RL   HLA Labratory, JiLin Province Blood Center, 5916 Ziyou Road, Changchun,
RL   JiLin 130031, China
XX
DR   MD5; 6877d1401f8fb0a337936addb04d99dc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..267
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>267
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1119"
FT   mRNA            <1..>267
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1119"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>267
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1119"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:E5G6F9"
FT                   /db_xref="IMGT/HLA:A*11:98"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:E5G6F9"
FT                   /protein_id="ADQ92360.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAHSQIDRVDLGTLRGYYNQSED"
FT   exon            <1..>267
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1119"
FT                   /number=2
XX
SQ   Sequence 267 BP; 53 A; 82 C; 94 G; 38 T; 0 other;
     tcccactcca tgaggtattt ctacacctcc gtgtcccggc ccggccgcgg ggagccccgc        60
     ttcatcgccg tgggctacgt ggacgacacg cagttcgtgc ggttcgacag cgacgccgcg       120
     agccagagga tggagccgcg ggcgccgtgg atagagcagg aggggccgga gtattgggac       180
     caggagacac ggaatgtgaa ggcccactca cagattgacc gagtggacct ggggaccctg       240
     cgcggctact acaaccagag cgaggac                                           267
//


spacer
spacer