Dbfetch

ID   HM627246; SV 1; linear; genomic DNA; STD; HUM; 796 BP.
XX
AC   HM627246;
XX
DT   19-NOV-2010 (Rel. 106, Created)
DT   19-NOV-2010 (Rel. 106, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*51var allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-796
RA   Recker K., Fuerst D., Koenig M., Mytilineos J.;
RT   "A new variant of HLA-B*51";
RL   Unpublished.
XX
RN   [2]
RP   1-796
RA   Recker K., Fuerst D., Koenig M., Mytilineos J.;
RT   ;
RL   Submitted (02-JUL-2010) to the INSDC.
RL   Transplantation Immunology, IKT Ulm, Helmholtzstrasse 10, Ulm 89081,
RL   Germany
XX
DR   MD5; 4c818ac336efa3fb2c5bd16239b53ae0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..796
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>796
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51var"
FT   mRNA            join(<1..270,521..>796)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51var"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,521..>796)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51var"
FT                   /product="MHC class I antigen"
FT                   /note="human leucocyte antigen"
FT                   /db_xref="IMGT/HLA:B*51:103"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:E5FXC4"
FT                   /protein_id="ADQ12888.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRIALRYYNQSEAGSHTWQTMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRHLENGKETLQRA"
XX
SQ   Sequence 796 BP; 143 A; 266 C; 281 G; 106 T; 0 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ctccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     ggggctcggg ggacggtgct gaccgcgggg ccggggccag ggtctcacac ttggcagacg       540
     atgtatggct gcgacgtggg gccggacggg cgcctcctcc gcgggcataa ccagtacgcc       600
     tacgacggca aagattacat cgccctgaac gaggacctga gctcctggac cgcggcggac       660
     accgcggctc agatcaccca gcgcaagtgg gaggcggccc gtgaggcgga gcagctgaga       720
     gcctacctgg agggcctgtg cgtggagtgg ctccgcagac acctggagaa cgggaaggag       780
     acgctgcagc gcgcgg                                                       796
//