spacer

EBI Dbfetch

ID   HM543719; SV 1; linear; genomic DNA; STD; HUM; 3327 BP.
XX
AC   HM543719;
XX
DT   29-DEC-2010 (Rel. 107, Created)
DT   09-SEP-2012 (Rel. 114, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*52:01-1new allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3327
RX   DOI; 10.1111/j.1744-313X.2011.01016.x.
RX   PUBMED; 21585707.
RA   Zhu F., He Y., Zhang W., He J., He J., Xu X., Lv H., Yan L.;
RT   "Analysis for complete genomic sequence of HLA-B and HLA-C alleles in the
RT   Chinese Han population";
RL   Int. J. Immunogenet. 38(4):281-284(2011).
XX
RN   [2]
RP   1-3327
RA   Zhu F., Yan L., He Y.;
RT   "Full length sequences of HLA-B*52:01 were identified by PCR-SBT";
RL   Unpublished.
XX
RN   [3]
RP   1-3327
RA   Zhu F., Yan L., He Y.;
RT   ;
RL   Submitted (14-JUN-2010) to the INSDC.
RL   Institute of Transfusion Medicine, Blood Center of Zhejiang Province, 345
RL   Wulin Road, Hangzhou, Zhejiang 310006, China
XX
DR   MD5; ff0ebc333c63692ac07e7b95c6febbd0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3327
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <285..>2973
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*52:01-1new"
FT   mRNA            join(<285..357,487..756,1002..1277,1853..2128,2233..2349,
FT                   2791..2823,2930..>2973)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*52:01-1new"
FT                   /product="MHC class I antigen"
FT   CDS             join(285..357,487..756,1002..1277,1853..2128,2233..2349,
FT                   2791..2823,2930..2973)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*52:01-1new"
FT                   /product="MHC class I antigen"
FT                   /note="HLA antigen"
FT                   /db_xref="GOA:Q0EFB2"
FT                   /db_xref="IMGT/HLA:B*52:01:01:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q0EFB2"
FT                   /protein_id="ADU18071.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRI
FT                   ALRYYNQSEAGSHTWQTMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRHLENGKETLQRADPPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
XX
SQ   Sequence 3327 BP; 621 A; 968 C; 1043 G; 695 T; 0 other;
     gatcaggacg aagtcccagg ccccgggcgg ggctctcagg gtctcaggct ccgagagcct        60
     tgtctgcatt ggggaggcgc agcgttgggg attccccact cccacgagtt tcacttcttc       120
     tcccaaccta tgtcgggtcc ttcttccagg atactcgtga cgcgtcccca tttcccactc       180
     ccattgggtg tcggatatct agagaagcca atcagtgtcg ccggggtccc agttctaaag       240
     tccccacgca cccacccgga ctcagaatct cctcagacgc cgagatgcgg gtcacggcgc       300
     cccgaaccgt cctcctgctg ctctgggggg cagtggccct gaccgagacc tgggccggtg       360
     agtgcggggt cgggagggaa atggcctctg tggggaggag cgaggggacc gcaggcgggg       420
     gcgcaggacc tgaggagccg cgccgggagg agggtcgggc gggtctcagc ccctcctcgc       480
     ccccaggctc ccactccatg aggtatttct acaccgccat gtcccggccc ggccgcgggg       540
     agccccgctt catcgcagtg ggctacgtgg acgacaccca gttcgtgagg ttcgacagcg       600
     acgccgcgag tccgaggacg gagccccggg cgccatggat agagcaggag gggccggagt       660
     attgggaccg ggagacacag atctccaaga ccaacacaca gacttaccga gagaacctgc       720
     ggatcgcgct ccgctactac aaccagagcg aggccggtga gtgaccccgg cccggggcgc       780
     aggtcacgac tccccatccc ccacgtacgg cccgggtcgc cccgagtctc cgggtccgag       840
     atccgcctcc ctgaggccgc gggacccgcc cagaccctcg accggcgaga gccccaggcg       900
     cgtttacccg gtttcatttt cagttgaggc caaaatcccc gcgggttggt cggggcgggg       960
     cggggctcgg gggacggtgc tgaccgcggg gccggggcca gggtctcaca cttggcagac      1020
     gatgtatggc tgcgacgtgg ggccggacgg gcgcctcctc cgcgggcata accagtacgc      1080
     ctacgacggc aaagattaca tcgccctgaa cgaggacctg agctcctgga ccgcggcgga      1140
     caccgcggct cagatcaccc agcgcaagtg ggaggcggcc cgtgaggcgg agcagctgag      1200
     agcctacctg gagggcctgt gcgtggagtg gctccgcaga cacctggaga acgggaagga      1260
     gacgctgcag cgcgcgggta ccaggggcag tggggagcct tccccatctc ctataggtcg      1320
     ccggggatgg cctcccacga gaagaggagg aaaatgggat cagcgctaga atgtcgccct      1380
     cccttgaatg gagaatggca tgagttttcc tgagtttcct ctgagggccc cctcttctct      1440
     ctaggacaat taagggatga cgtctctgag gaaatggagg ggaagacagt ccctagaata      1500
     ctgatcaggg gtcccctttg acccctgcag cagccttggg aaccgtgact tttcctctca      1560
     ggccttgttc tctgcctcac actcagtgtg tttggggctc tgattccagc acttctgagt      1620
     cactttacct ccactcagat caggagcaga agtccctgtt ccccgctcag agactcgaac      1680
     tttccaatga ataggagatt atcccaggtg cctgcgtcca ggctggtgtc tgggttctgt      1740
     gccccttccc cacaccaggt gtcctgtcca ttctcaggct ggtcacatgg gtggtcctag      1800
     ggtgtcccat gagagatgca aagcgcctga attttctgac tcttcccatc agacccccca      1860
     aagacacacg tgacccacca ccccgtctct gaccatgagg ccaccctgag gtgctgggcc      1920
     ctgggcttct accctgcgga gatcacactg acctggcagc gggatggcga ggaccaaact      1980
     caggacactg agcttgtgga gaccagacca gcaggagata gaaccttcca gaagtgggca      2040
     gctgtggtgg tgccttctgg agaagagcag agatacacat gccatgtaca gcatgagggg      2100
     ctgccgaagc ccctcaccct gagatggggt aaggaggggg atgaggggtc atatctcttc      2160
     tcagggaaag caggagccct tctggagccc ttcagcaggg tcagggcccc tcgtcttccc      2220
     ctcctttccc agagccatct tcccagtcca ccatccccat cgtgggcatt gttgctggcc      2280
     tggctgtcct agcagttgtg gtcatcggag ctgtggtcgc tactgtgatg tgtaggagga      2340
     agagctcagg tagggaaggg gtgaggggtg gggtctgggt tttcttgtcc cactgggggt      2400
     ttcaagcccc aggtagaagt gttccctgcc tcattactgg gaagcagcat ccacacaggg      2460
     gctaacgcag cctgggaccc tgtgtgccag cacttactct tttgtgcagc acatgtgaca      2520
     atgaaggacg gatgtatcac cttgatggtt gtggtgttgg ggtcctgatt tcagcattca      2580
     tgagtcaggg gaaggtccct gctaaggaca gaccttagga gggcagttgg tccaggaccc      2640
     acacttgctt tcctcgtgtt tcctgatcct gccttgggtc tgtagtcata cttctggaaa      2700
     ttccttttgg gtccaagacg aggaggttcc tctaagatct catggccctg cttcctccca      2760
     gtcccctcac aggacatttt cttcccacag gtggaaaagg agggagctac tctcaggctg      2820
     cgtgtaagtg gtgggggtgg gagtgtggag gagctcaccc accccataat tcctcctgtc      2880
     ccacgtctcc tgcgggctct gaccaggtcc tgtttttgtt ctactccagc cagcgacagt      2940
     gcccagggct ctgatgtgtc tctcacagct tgaaaaggtg agattcttgg ggtctagagt      3000
     gggcgggggg ggcggggagg gggcagaggg gaaaggcctg ggtaatggag attctttgat      3060
     tgggatgttt cgcgtgtgtc gtgggctgtt cagagtgtca tcacttacca tgactaacca      3120
     gaatttgttc atgactgttg ttttctgtag cctgagacag ctgtcttgtg agggactgag      3180
     atgcaggatt tcttcactcc tcccctttgt gacttcaaga gcctctggca tctctttctg      3240
     caaaggcacc tgaatgtgtc tgcgtccctg ttagcataat gtgaggaggt ggagagacag      3300
     cccacccttg tgtccactgt gacccct                                          3327
//


spacer
spacer