Dbfetch

ID   HM535632; SV 1; linear; genomic DNA; STD; HUM; 1637 BP.
XX
AC   HM535632;
XX
DT   31-OCT-2010 (Rel. 106, Created)
DT   31-OCT-2010 (Rel. 106, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*370101 variant allele,
DE   exons 2 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1637
RA   Cao K., Wang Q., Semendyayeva M., Naim M., Lai C.-H., Ong G.,
RA   Reinsmoen N.L.;
RT   "Novel Sequences of B*370101 Variant";
RL   Unpublished.
XX
RN   [2]
RP   1-1637
RA   Cao K., Wang Q., Semendyayeva M., Naim M., Lai C.-H., Ong G.,
RA   Reinsmoen N.L.;
RT   ;
RL   Submitted (11-JUN-2010) to the INSDC.
RL   Medicine, Comprehensive Transplant Center, Cedars-Sinai Medical Center,
RL   8723 Alden Drive, SSB-197, Los Angeles, CA 90048, USA
XX
DR   MD5; dd53a35afff2fde78d35704063dde90d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1637
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1637
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*370101 variant"
FT   mRNA            join(<1..270,514..789,1362..>1637)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*370101 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,514..789,1362..>1637)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*370101 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*37:23"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:E3UPB1"
FT                   /protein_id="ADP02157.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYREDLRTLLRYYNQSEAGSHTIQRMSGCDVGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGTC
FT                   VEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLLKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*370101 variant"
FT                   /number=2
FT   gap             271..513
FT                   /estimated_length=243
FT   exon            514..789
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*370101 variant"
FT                   /number=3
FT   gap             790..1361
FT                   /estimated_length=572
FT   exon            1362..1637
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*370101 variant"
FT                   /number=4
XX
SQ   Sequence 1637 BP; 178 A; 258 C; 270 G; 116 T; 815 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagaggac ctgcggaccc       240
     tgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnggtctca caccatccag aggatgtctg       540
     gctgcgacgt ggggccggac gggcgcctcc tccgcgggta taaccagttc gcctacgacg       600
     gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg gacaccgcgg       660
     ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcaggac agagcctacc       720
     tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag gagacgctgc       780
     agcgcgcggn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn naccccccaa agacacatgt      1380
     gacccaccac cccatctctg accatgaggc caccctgagg tgctgggccc tgggcttcta      1440
     ccctgcggag atcacactga cctggcagcg ggatggcgag gaccaaactc aggacaccga      1500
     gcttgtggag accagaccag caggagatag aaccttccag aagtgggcag ctgtggtggt      1560
     gccttctgga gaagagcaga gatacacatg ccatgtacag catgaggggc tgctgaagcc      1620
     cctcaccctg agatggg                                                     1637
//