Dbfetch

ID   HM484299; SV 1; linear; genomic DNA; STD; HUM; 4254 BP.
XX
AC   HM484299;
XX
DT   04-NOV-2010 (Rel. 106, Created)
DT   04-NOV-2010 (Rel. 106, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*01:03 allele, promoter
DE   region and complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4254
RA   Xu Y., Deng Z., Yang B.;
RT   "Characterization and polymorphism analyses of HLA-A genomic full length in
RT   Chinese Han population";
RL   Unpublished.
XX
RN   [2]
RP   1-4254
RA   Xu Y., Deng Z., Yang B.;
RT   ;
RL   Submitted (10-JUN-2010) to the INSDC.
RL   Immunogenetic Laboratory, Shenzhen Blood Center, 2# Meigang South Street,
RL   Nigang West Road, Shenzhen, Guangdong 518035, China
XX
DR   MD5; c2734a9157def48d54a52f14097f9f25.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4254
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /PCR_primers="fwd_seq: actcagagctawggaatgatg, rev_seq:
FT                   atggagcagcaaagatgac"
FT                   /db_xref="taxon:9606"
FT   gene            1..4254
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01:03"
FT   misc_feature    1..819
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01:03"
FT                   /note="contains promoter and 5' UTR"
FT   mRNA            join(<820..892,1023..1292,1534..1809,2389..2664,2767..2883,
FT                   3326..3358,3501..3548,3718..4254)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01:03"
FT                   /product="MHC class I antigen"
FT   CDS             join(820..892,1023..1292,1534..1809,2389..2664,2767..2883,
FT                   3326..3358,3501..3548,3718..3722)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01:03"
FT                   /product="MHC class I antigen"
FT                   /note="glycoprotein; human leukocyte antigen class I
FT                   molecule"
FT                   /db_xref="GOA:C5IWX4"
FT                   /db_xref="IMGT/HLA:A*01:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:C5IWX4"
FT                   /protein_id="ADP09054.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGT
FT                   LRGYYNQSEDGSHTIQMMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYTQAASSDSAQGSDVSLTACKV"
FT   3'UTR           3723..4254
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01:03"
XX
SQ   Sequence 4254 BP; 885 A; 1160 C; 1254 G; 955 T; 0 other;
     gcaaatttaa agtaagacaa gcaggagtca cagatacatt gtctgggaaa gtgcaactta        60
     gtagctttgt gagtcctgtt gtaatgcttt tggacacatt tatacattaa ggggccaaag       120
     tcacattttt tacctattag attcctgatc attcaggggt taccaagatt ctgctaccca       180
     ctgtagttaa taaacaaaga gcaaattggt ctctattctg tctcatgcac tcaggcacaa       240
     cttttccgga ttaaaaacaa aaacaacaac aaaaatctac acctctattc ccagagcaag       300
     cttactctct ggcaccaaac tccatggggt gatttttctt ctagaagagt ccaggtggac       360
     aggtaaggag tgggagtcag ggagtccagt tcagggacag agataatggg atgaaaagtg       420
     aaaggagagg gacggggccc atgccgaggg tttctccctt gtttctcaga cagctcctgg       480
     gccaagactc agggagacat tgagacagag cgcttcgcac aggagcagag gggtcagggc       540
     gaagtcccag ggccccaggc gtggctctca gggtctcagg ccccgaaggc ggtgtatgga       600
     ttggggagtc ccagccttgg ggattcccca actccgcagt ttcttttctc cctctcccaa       660
     cctacgtagg gtccttcatc ctggatactc acgacgcgga cccagttctc actcccattg       720
     ggtgtcgggt ttccagagaa gccaatcagt gtcgtcgcgg tcgctgttct aaagtccgca       780
     cgcacccacc gggactcaga ttctccccag acgccgagga tggccgtcat ggcgccccga       840
     accctcctcc tgctactctc gggggccctg gccctgaccc agacctgggc gggtgagtgc       900
     ggggtcggga gggaaaccgc ctctgcgggg agaagcaagg ggccctcctg gcgggggcgc       960
     aggaccgggg gagccgcgcc gggaggaggg tcgggcaggt ctcagccact gctcgccccc      1020
     aggctcccac tccatgaggt atttcttcac atccgtgtcc cggcccggcc gcggggagcc      1080
     ccgcttcatc gccgtgggct acgtggacga cacgcagttc gtgcggttcg acagcgacgc      1140
     cgcgagccag aagatggagc cgcgggcgcc gtggatagag caggaggggc cggagtattg      1200
     ggaccaggag acacggaata tgaaggccca ctcacagact gaccgagcga acctggggac      1260
     cctgcgcggc tactacaacc agagcgagga cggtgagtga ccccggcccg gggcgcaggt      1320
     cacgacccct catcccccac ggacgggcca ggtcgcccac agtctccggg tccgagatcc      1380
     accccgaagc cgcgggactc cgagaccctt gtcccgggag aggcccaggc gcctttaccc      1440
     ggtttcattt tcagtttagg ccaaaaatcc ccccgggttg gtcggggcgg ggcggggctc      1500
     gggggactgg gctgaccgcg gggtcggggc caggttctca caccatccag atgatgtatg      1560
     gctgcgacgt ggggccggac gggcgcttcc tccgcgggta ccggcaggac gcctacgacg      1620
     gcaaggatta catcgccctg aacgaggacc tgcgctcttg gaccgcggcg gacatggcag      1680
     ctcagatcac caagcgcaag tgggaggcgg tccatgcggc ggagcagcgg agagtctacc      1740
     tggagggccg gtgcgtggac gggctccgca gatacctgga gaacgggaag gagacgctgc      1800
     agcgcacggg taccaggggc cacggggcgc ctccctgatc gcctatagat ctcccgggct      1860
     ggcctcccac aaggagggga gacaattggg accaacacta gaatatcacc ctccctctgg      1920
     tcctgaggga gaggaatcct cctgggtttc cagatcctgt accagagagt gactctgagg      1980
     ttccgccctg ctctctgaca caattaaggg ataaaatctc tgaaggagtg acgggaagac      2040
     gatccctcga atactgatga gtggttccct ttgacaccgg cagcagcctt gggcccgtga      2100
     cttttcctct caggccttgt tctctgcttc acactcaatg tgtgtggggg tctgagtcca      2160
     gcacttctga gtctctcagc ctccactcag gtcaggacca gaagtcgctg ttcccttctc      2220
     agggaataga agattatccc aggtgcctgt gtccaggctg gtgtctgggt tctgtgctct      2280
     cttccccatc ccgggtgtcc tgtccattct caagatggcc acatgcgtgc tggtggagtg      2340
     tcccatgaca gatgcaaaat gcctgaattt tctgactctt cccgtcagac ccccccaaga      2400
     cacatatgac ccaccacccc atctctgacc atgaggccac cctgaggtgc tgggccctgg      2460
     gcttctaccc tgcggagatc acactgacct ggcagcggga tggggaggac cagacccagg      2520
     acacggagct cgtggagacc aggcctgcag gggatggaac cttccagaag tgggcggctg      2580
     tggtggtgcc ttctggagag gagcagagat acacctgcca tgtgcagcat gagggtctgc      2640
     ccaagcccct caccctgaga tggggtaagg agggagatgg gggtgtcatg tctcttaggg      2700
     aaagcaggag cctctctgga gacctttagc agggtcaggg cccctcacct tcccctcttt      2760
     tcccagagct gtcttcccag cccaccatcc ccatcgtggg catcattgct ggcctggttc      2820
     tccttggagc tgtgatcact ggagctgtgg tcgctgctgt gatgtggagg aggaagagct      2880
     caggtggaga aggggtgaag ggtggggtct gagatttctt gtctcactga gggttccaag      2940
     ccccagctag aaatgtgccc tgtctcatta ctgggaagca ccttccacaa tcatgggccg      3000
     acccagcctg ggccctgtgt gccagcactt actcttttgt aaagcacctg ttaaaatgaa      3060
     ggacagattt atcaccttga ttacggcggt gatgggacct gatcccagca gtcacaagtc      3120
     acaggggaag gtccctgagg acagacctca ggagggctat tggtccagga cccacacctg      3180
     ctttcttcat gtttcctgat cccgccctgg gtctgcagtc acacatttct ggaaacttct      3240
     ctggggtcca agactaggag gttcctctag gaccttaagg ccctggctcc tttctggtat      3300
     ctcacaggac attttcttcc cacagataga aaaggaggga gttacactca ggctgcaagt      3360
     aagtatgaag gaggctgatg cctgaggtcc ttgggatatt gtgtttggga gcccatgggg      3420
     gagctcaccc accccacaat tcctcctcta gccacatctt ctgtgggatc tgaccaggtt      3480
     ctgtttttgt tctaccccag gcagtgacag tgcccagggc tctgatgtgt ctctcacagc      3540
     ttgtaaaggt gagagcttgg agggcctgat gtgtgttggg tgttgggtgg aacagtggac      3600
     acagctgtgc tatggggttt ctttgcgttg gatgtattga gcatgcgatg ggctgtttaa      3660
     ggtgtgaccc ctcactgtga tggatatgaa tttgttcatg aatatttttt tctatagtgt      3720
     gagacagctg ccttgtgtgg gactgagagg caagagttgt tcctgccctt ccctttgtga      3780
     cttgaagaac cctgactttg tttctgcaaa ggcacctgca tgtgtctgtg ttcgtgtagg      3840
     cataatgtga ggaggtgggg agagcacccc acccccatgt ccaccatgac cctcttccca      3900
     cgctgacctg tgctccctct ccaatcatct ttcctgttcc agagaggtgg ggctgaggtg      3960
     tctccatctc tgtctcaact tcatggtgca ctgagctgta acttcttcct tccctattaa      4020
     aattagaacc tgagtataaa tttactttct caaattcttg ccatgagagg ttgatgagtt      4080
     aattaaagga gaagattcct aaaatttgag agacaaaatt aatggaacgc atgagaacct      4140
     tccagagtcc acgtgttgct tatgctgatt tgttgcaggg gaggagagta gatggggctg      4200
     tgcccagttt ctgttccggc caccatgggc tttatgtggt cacagctcac ctgg            4254
//