spacer

EBI Dbfetch

ID   HM484297; SV 1; linear; genomic DNA; STD; HUM; 4256 BP.
XX
AC   HM484297;
XX
DT   04-NOV-2010 (Rel. 106, Created)
DT   04-NOV-2010 (Rel. 106, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*24:20 allele, promoter
DE   region and complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4256
RA   Xu Y., Deng Z., Yang B.;
RT   "Characterization and polymorphism analyses of HLA-A genomic full length in
RT   Chinese Han population";
RL   Unpublished.
XX
RN   [2]
RP   1-4256
RA   Xu Y., Deng Z., Yang B.;
RT   ;
RL   Submitted (10-JUN-2010) to the INSDC.
RL   Immunogenetic Laboratory, Shenzhen Blood Center, 2# Meigang South Street,
RL   Nigang West Road, Shenzhen, Guangdong 518035, China
XX
DR   MD5; a8d2c6f4fdbffa34189007df0ed6bdcc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4256
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /PCR_primers="fwd_seq: actcagagctawggaatgatg, rev_seq:
FT                   atggagcagcaaagatgac"
FT                   /db_xref="taxon:9606"
FT   gene            1..4256
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24:20"
FT   misc_feature    1..822
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24:20"
FT                   /note="contains promoter and 5' UTR"
FT   mRNA            join(<823..895,1026..1295,1537..1812,2392..2667,2770..2886,
FT                   3329..3361,3504..3551,3720..4256)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24:20"
FT                   /product="MHC class I antigen"
FT   CDS             join(823..895,1026..1295,1537..1812,2392..2667,2770..2886,
FT                   3329..3361,3504..3551,3720..3724)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24:20"
FT                   /product="MHC class I antigen"
FT                   /note="glycoprotein; human leukocyte antigen class I
FT                   molecule"
FT                   /db_xref="GOA:C5IWY4"
FT                   /db_xref="IMGT/HLA:A*24:20"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C5IWY4"
FT                   /protein_id="ADP09052.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSQSMRYFSTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRI
FT                   ALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTVPIVGIIAGLVLLGAVITGAVVAAVMWRRNSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   3'UTR           3725..4256
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24:20"
XX
SQ   Sequence 4256 BP; 896 A; 1165 C; 1242 G; 953 T; 0 other;
     gtaaatttaa aatactacaa gcaggagtca cagatacatt gtctgggaaa atgcaactta        60
     gtagctttgt gagtcctgtt gtaaggcttt tggacacatt tatacatcaa ggggccaaag       120
     tcacattttt tacctattag attcctgatc attcaggggt taccaagatt ctgctaccca       180
     ctgtagttaa taaacaaaga gcaaattggt ctctattctg tctcatgcac tcaggcgcaa       240
     ctcttcctga ttaaaaacaa aaacaacaac aacaaaaatc tacacctcca ttcccagagc       300
     aagcttactc tctggcacca aactccatgg gatgattttt cttctagaag agtccaggtg       360
     gacaggtaag gagtgggagt cagggagtcc agttcaggga cagagattac gggatgaaaa       420
     gtgaaaggag agggacgggg cccatgccga gggtttctcc cttgtttctc agacagctct       480
     tgggccaaga ttcagggaga cattgagaca gagcgcttgg cacagaagca gaggggtcag       540
     ggcgaagtcc cagggcccca ggcgtggctc tcagggtctc aggccccgaa ggcggtgtat       600
     ggattgggga gtcccagcct tggggattcc ccaactccgc agtttctttt ctccctctcc       660
     caacctatgt agggtccttc ttcctggata ctcacgacgc ggacccagtt ctcactccca       720
     ttgggtgtcg ggtttccaga gaagccaatc agtgtcgtcg cggtcgctgt tctaaagtcc       780
     gcacgcaccc accgggactc agattctccc cagacgccga ggatggccgt catggcgccc       840
     cgaaccctcg tcctgctact ctcgggggcc ctggccctga cccagacctg ggcaggtgag       900
     tgcggggtcg ggagggaaac ggcctctgcg gggagaagca aggggcccgc ctggcggggg       960
     cgcaagaccc gggaagccgc gccgggagga gggtcgggcg ggtctcagcc actcctcgtc      1020
     cccaggctcc caatccatga ggtatttctc cacatccgtg tcccggcccg gccgcgggga      1080
     gccccgcttc atcgccgtgg gctacgtgga cgacacgcag ttcgtgcggt tcgacagcga      1140
     cgccgcgagc cagaggatgg agccgcgggc gccgtggata gagcaggagg ggccggagta      1200
     ttgggacgag gagacaggga aagtgaaggc ccactcacag actgaccgag agaacctgcg      1260
     gatcgcgctc cgctactaca accagagcga ggccggtgag tgaccccggc ccggggcgca      1320
     ggtcacgacc cctcatcccc cacggacggg ccgggtcgcc cacagtctcc gggtccgaga      1380
     tccaccccga agccgcggga ccccgagacc cttgccccgg gagaggccca ggcgccttaa      1440
     cccggtttca ttttcagttt aggccaaaaa tccccccggg ttggtcgggg ccgggcgggg      1500
     ctcgggggac tgggctgacc gcggggtcgg ggccaggttc tcacaccctc cagatgatgt      1560
     ttggctgcga cgtggggtcg gacgggcgct tcctccgcgg gtaccaccag tacgcctacg      1620
     acggcaagga ttacatcgcc ctgaaagagg acctgcgctc ttggaccgcg gcggacatgg      1680
     cggctcagat caccaagcgc aagtgggagg cggcccatgt ggcggagcag cagagagcct      1740
     acctggaggg cacgtgcgtg gacgggctcc gcagatacct ggagaacggg aaggagacgc      1800
     tgcagcgcac gggtaccagg ggccacgggg cgcctacctg atcgcctgta ggtctcccgg      1860
     gctggcctcc cacaaggagg ggagacaatt gggaccaaca ctagaatatc gccctccctc      1920
     tggtcctgag ggagaggaat cctcctgggt ttccagatcc tgtaccagag agtgactctg      1980
     aggttccgcc ctgctctctg acacaattaa gggataaaat ctctgacgga atgacggaaa      2040
     gacgatccct cgaatactga tgactggttc cctttgacac cggcagcagc cttgggaccg      2100
     tgacttttcc tctcaggcct tgttctctgc ttcacactca atgtgtgtgg gggtctgagt      2160
     ccagcacttc tgagtccctc agcctccact caggtcagga ccagaagtcg ctgttccctc      2220
     ctcagggaat agaagattat cccaggtgcc tgtgtccagg ctggtgtctg ggttctgtgc      2280
     tctcttcccc atcccgggtg tcctgtccat tctcaagatg gccacatgca tgctggtgga      2340
     gtgtcccatg acagatgcaa aatgcctgaa ttttctgact cttcccgtca gaccccccca      2400
     agacacatat gacccaccac cccatctctg accatgaggc cactctgaga tgctgggccc      2460
     tgggcttcta ccctgcggag atcacactga cctggcagcg ggatggggag gaccagaccc      2520
     aggacacgga gcttgtggag accaggcctg caggggatgg aaccttccag aagtgggcag      2580
     ctgtggtggt accttctgga gaggagcaga gatacacctg ccatgtgcag catgagggtc      2640
     tgcccaagcc cctcaccctg agatggggta aggagggaga tgggggtgtc atgtctctta      2700
     gggaaagcag gagcctctct ggagaccttt agcagggtca gggcccctca ccttcccctc      2760
     ttttcccaga gccatcttcc cagcccaccg tccccatcgt gggcatcatt gctggcctgg      2820
     ttctccttgg agctgtgatc actggagctg tggtcgctgc tgtgatgtgg aggaggaaca      2880
     gctcaggtgg agaaggggtg aagggtgggg tctgagattt cttgtctcac tgagggttcc      2940
     aagccccagc tagaaatgtg ccctgtctca ttactgggaa gcaccatcca caatcatggg      3000
     ccgacccagc ctgggccctg tgtgccagca cttactcttt tgtaaagcac ctgtgacaat      3060
     gaaggacaga tttatcacct tgattatggc ggtgatggga cctgatccca gcagtcacaa      3120
     gtcacagggg aaggtccctg acgacagatc tcaggagggc gattggtcca gggcccacat      3180
     ctgctttctt catgtttcct gatcctgccc tgggtctgca gtcacacatt tctggaaact      3240
     tctctggggt ccaagactag gaggttcctc taggacctta aggccctggc tcctttctgg      3300
     tatctcacag gacattttct tcccacagat agaaaaggag ggagctactc tcaggctgca      3360
     agtaagtatg aaggaggctg atgcctgagg tccttgggat attgtgtttg ggagcccatg      3420
     ggggagctca accaccccac aattcctcct ctagccacat cttctgtggg atctgaccag      3480
     gttctgtttt tgttctaccc caggcagtga cagtgcccag ggctctgatg tgtctctcac      3540
     agcttgtaaa ggtgagagct tggagggcct gatgtgtgtt gggtgttggg cggaacagtg      3600
     gacacagctg tgctatgggg tttctttgca ttggatgtat tgagcatgcg atgggctgtt      3660
     taaagtgtga cccctcactg tgacagatat gaagttgttc atgaattttt tttctatagt      3720
     gtgagacagc tgccttgtgt gggactgaga ggcaagagtt gttcctgccc ttccctttgt      3780
     gacttgaaga accctgactt tgtttctgca aaggcacctg catgtgtctg tgttcatgta      3840
     ggcataatgt gaggaggtgg ggagaccacc ccacccccat gtccaccatg accctcttcc      3900
     cacgctgacc tgtgctccct ccccaatcat ctttcctgtt gcagagaggt ggggctgagg      3960
     tgtctccatc tctgtctcaa cttcatggtg cactgagctg taacttcttc cttccctatt      4020
     aaaattagaa cctgagtata aatttacttt ctcaaattct tgccatgaga ggttgatgag      4080
     ttaattaaag gagaagattc ctaaaatttg agagacaaaa taaatggaac acatgagaac      4140
     cttccagagt ccacgtgttg cttatgctga tttgttgcag gggaggagac tagatggggc      4200
     tgtgcccagt ttctgttccg gccaccatgg gctttatgtg gtcactgctt ggctgg          4256
//


spacer
spacer