Dbfetch

ID   HM484295; SV 1; linear; genomic DNA; STD; HUM; 4271 BP.
XX
AC   HM484295;
XX
DT   04-NOV-2010 (Rel. 106, Created)
DT   04-NOV-2010 (Rel. 106, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*34:01:01 allele,
DE   promoter region and complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4271
RA   Xu Y., Deng Z., Yang B.;
RT   "Characterization and polymorphism analyses of HLA-A genomic full length in
RT   Chinese Han population";
RL   Unpublished.
XX
RN   [2]
RP   1-4271
RA   Xu Y., Deng Z., Yang B.;
RT   ;
RL   Submitted (10-JUN-2010) to the INSDC.
RL   Immunogenetic Laboratory, Shenzhen Blood Center, 2# Meigang South Street,
RL   Nigang West Road, Shenzhen, Guangdong 518035, China
XX
DR   MD5; 73b3438d77f2e61208f8008135f441ed.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4271
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /PCR_primers="fwd_seq: actcagagctawggaatgatg, rev_seq:
FT                   atggagcagcaaagatgac"
FT                   /db_xref="taxon:9606"
FT   gene            1..4271
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*34:01:01"
FT   misc_feature    1..822
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*34:01:01"
FT                   /note="contains promoter and 5' UTR"
FT   mRNA            join(<823..895,1026..1295,1537..1812,2413..2688,2788..2904,
FT                   3343..3375,3518..3565,3735..4271)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*34:01:01"
FT                   /product="MHC class I antigen"
FT   CDS             join(823..895,1026..1295,1537..1812,2413..2688,2788..2904,
FT                   3343..3375,3518..3565,3735..3739)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*34:01:01"
FT                   /product="MHC class I antigen"
FT                   /note="glycoprotein; human leukocyte antigen class I
FT                   molecule"
FT                   /db_xref="GOA:B1PKZ1"
FT                   /db_xref="IMGT/HLA:A*34:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B1PKZ1"
FT                   /protein_id="ADP09050.1"
FT                   /translation="MAIMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRKVKAQSQTDRVDLGT
FT                   LRGYYNQSEDGSHTIQRMYGCDVGPDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWETAHEAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGILAGLVLFGAVIAGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDMSLTACKV"
FT   3'UTR           3740..4271
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*34:01:01"
XX
SQ   Sequence 4271 BP; 895 A; 1172 C; 1249 G; 955 T; 0 other;
     gtaaatttaa aatactacaa gcaggagtca cagatacatt gtctgggaaa atgcaactta        60
     gtagctttgt gagtcctgtt gtaaggcttt tggacacatt tatacatcaa ggggccaaag       120
     tcacattttt tacctattag attcctgatc attcaggggt taccaagatt ctgctaccca       180
     ctgtagttaa taaacaaaga gcaaactggt ctctattctg tctcatgcac tcaggcgcaa       240
     ctcttcccga ttaaaaacaa aaacaacaac aacaaaaatc tacacctcca ttcccagagc       300
     aagcttactc tctggcacca aactccatgg gatgattttt cttctagaag agtccaggtg       360
     gacaggtaag gagtgggagt cagggagtcc agttcaggga cagagattac gggataaaaa       420
     gtgaaaggag agggacgggg cccatgccga gggtttctcc catgtttctc agacagctct       480
     tgggccaaga ctcagggaga cattgagaca gagcgcttgg cacaggagca gaggggtcag       540
     ggcgaagtcc cagggcccca ggcgtggctc tcagggtctc aggccccgaa ggcggtgtat       600
     ggattgggga gtcccagcct tggggattcc ccaactccgc agtttctttt ctccctctcc       660
     caacctatgt agggtccttc ttcctggata ctcacgacgc ggacccagtt ctcactccca       720
     ttgggtgtcg ggtttccaga gaagccaatc agtgtcgtcg cggtcgcggt tctaaagtcc       780
     gcacgcaccc accgggactc agattctccc cagacgccga ggatggccat catggcgccc       840
     cgaaccctcg tcctgctact ctcgggggcc ctggccctga cccagacctg ggcgggtgag       900
     tgcggggtcg ggagggaaac ggcctctgtg gggagaagca aggggcccgc ccggcggggg       960
     cgcaggaccc gggaagccgc gcctggagga gggtcgggcg ggtctcagcc actcctcgcc      1020
     cccaggctcc cactccatga ggtatttcta cacctccgtg tcccggcccg gccgcgggga      1080
     gccccgcttc atcgccgtgg gctacgtgga cgacacgcag ttcgtgcggt tcgacagcga      1140
     cgccgcgagc cagaggatgg agccgcgggc gccgtggata gagcaggagg ggccggagta      1200
     ttgggaccgg aacacacgga aagtgaaggc ccagtcacag actgaccgag tggacctggg      1260
     gaccctgcgc ggctactaca accagagcga ggacggtgag tgaccccggc ccggggcgca      1320
     ggtcacgacc cctcatcccc cacggacggg ccaggtcgcc cacagtctcc gggtccgaga      1380
     tccgccccga agccgcggga ccccgagacc cttgccccgg gagaggccca ggcgccttta      1440
     cccggtttca ttttcagttt aggccaaaaa tccccccggg ttggtcgggg cggggcgggg      1500
     ctcgggggac cgggctgacc tcggggtccg ggccaggttc tcacaccatc cagaggatgt      1560
     atggctgcga cgtggggccg gacgggcgct tcctccgcgg gtaccagcag gacgcttacg      1620
     acggcaagga ttacatcgcc ctgaacgagg acctgcgctc ttggaccgcg gcggacatgg      1680
     cggctcagat cacccagcgc aagtgggaga cggcccatga ggcggagcag tggagagcct      1740
     acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggagacgc      1800
     tgcagcgcac gggtaccagg ggccacgggg cgcctccctg atcgcctata gatctcccgg      1860
     gctggcctcc cacaaggagg ggagacaatt gggaccaaca ctagaatatc gccctccctc      1920
     tggtcctgag ggagaggaat cctcctgggt ttccagatcc tgtaccagag agtgactctg      1980
     aggttccgcc ctgctctctg acacaattaa gggataaaat ctctgaagga atgacgggaa      2040
     gacgatccct cgaatactga tgagtggttc cctttgacac acaccggcag cagccttggg      2100
     cccgtgactt ttcctctcag gccttgttct ctgcttcaca ctcaatgtgt gtgggggtct      2160
     gagtccagca cttctgagtc cctcagcctc cactcaggtc aggaccagaa gtcgctgttc      2220
     cctcttcagg gactagaatt ttccacggaa taggagatta tcccaggtgc ctgtgtccag      2280
     gctggtgtct gggttctgtg ctcccttccc catcccaggt gtcctgtcca ttctcaagat      2340
     agccacatgt gtgctggagg agtgtcccat gacagatgca aaatgcctga atgttctgac      2400
     tcttcctgac agacgccccc aagacacata tgactcacca cgctgtctct gaccatgagg      2460
     ccaccctgag gtgctgggcc ctgagcttct accctgcgga gatcacactg acctggcagc      2520
     gggatgggga ggaccagacc caggacacgg agctcgtgga gaccaggcct gcaggggatg      2580
     gaaccttcca gaagtgggcg tctgtggtgg tgccttctgg acaggagcag agatacacct      2640
     gccatgtgca gcatgagggt ctgcccaagc ccctcaccct gagatggggt aaggagggag      2700
     acgggggtgt catgtctttt agggaaagca ggagcctctc tgacctttag cagggtcagg      2760
     gcccctcacc ttcccctctt ttcccagagc cgtcttccca gcccaccatc cccatcgtgg      2820
     gcatccttgc tggcctggtt ctctttggag ctgtgatcgc tggagctgtg gtcgctgctg      2880
     tgatgtggag gaggaagagc tcaggtgggg aagggatgaa gggtgggtct gagatttctt      2940
     gtctcactga gggttccaag acccaggtag aagtgtgccc tgcctcgtta ctgggaagca      3000
     ccatccacaa ttatgagcct acccagcctg ggccctgtgt gccagcactt actcttttgt      3060
     aaagcacctg ttaaaatgaa ggacagattt atcaccttga ttacggcggt gatgggacct      3120
     gatcccagca gtcacaagtc acaggggaag gtccctgagg accttcagga gggcggttgg      3180
     tccaggaccc acacctgctt tcttcatgtt tcctgatcct gccctgggtc tgcagtcaca      3240
     catttctgga aacttctctg aggtccaaga cttggaggtt cctctaggac cttaaggccc      3300
     tggctccttt ctggtatctc acaggacatt ttcttcccac agatagaaaa ggagggagct      3360
     actctcaggc tgcaagtaag tatgaaggag gctgatgcct gaggtccttg ggatattgtg      3420
     tttgggagcc cgtgggggag ctcacccacc ccacaattcc tcctctagcc acatcttctg      3480
     tgggatctga ccaggttctg tttttgtcct accccaggca gtgacagtgc ccagggctct      3540
     gatatgtctc tcacagcttg taaaggtgag agcctggagg gcctgatgtg tgttgggtgt      3600
     tgggcggaac agtggacgca gctgtgctat ggggtttctt tgcattggat gtattgagca      3660
     tgcaatgggc tgtttaaagt gtgactcctc actgtgacag atacgaattt gttcatgaat      3720
     atttttttct atagtgtgag acagctgcct tgtgtgggac tgagaggcaa gatttgttcc      3780
     tgcccttccc tttgtgactt gaagaaccct gactttgttt ctgcaaaggc acctgcatgt      3840
     gtctgtgttc ttgtaggcat aatgtgagga ggtggggaga ccaccccacc cccatgtcca      3900
     ccatgaccct cttcccacgc tgacctgtgc tccctcccca atcatctttc ctgttccaga      3960
     gaggtggggc tgaggtgtct ccatctctgc ctcaacttca tggtgcactg agctgtaact      4020
     ttttccttcc ctattaaaat tagaacctga gtataaattt actttctcaa attcttgcca      4080
     tgagaggttg atgagttaat taaaggagaa gattcctaaa atttgagaga caaaataaat      4140
     ggaacacatg agaaccttcc agagtccacg tgttgcttat gctgatttgt tgcaggggag      4200
     gagagtagat ggggctgtgc ccagtttctg ttccggccac catgggcttt atgtggtcac      4260
     tgcttggctg g                                                           4271
//