spacer

EBI Dbfetch

ID   HM461986; SV 1; linear; genomic DNA; STD; HUM; 1641 BP.
XX
AC   HM461986;
XX
DT   21-OCT-2010 (Rel. 106, Created)
DT   21-OCT-2010 (Rel. 106, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*0229 allele, exons 2
DE   through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1641
RA   Cao K., Wang Q., Semendyayeva M., Naim M., Lai C.-H., Ong G.;
RT   "Sequences of A*0229";
RL   Unpublished.
XX
RN   [2]
RP   1-1641
RA   Cao K., Wang Q., Semendyayeva M., Naim M., Lai C.-H., Ong G.;
RT   ;
RL   Submitted (07-JUN-2010) to the INSDC.
RL   Medicine, Comprehensive Transplant Center, Cedars-Sinai Medical Center,
RL   8723 Alden Dr. SSB-197, Los Angeles, CA 90048, USA
XX
DR   MD5; cfde8093797b2bb08f8c0b2c04176265.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1641
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1641
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0229"
FT   mRNA            join(<1..270,512..787,1366..>1641)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0229"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..787,1366..>1641)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0229"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:E3UM70"
FT                   /db_xref="IMGT/HLA:A*02:29"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:E3UM70"
FT                   /protein_id="ADO40097.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGETRQVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGS
FT                   DWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0229"
FT                   /number=2
FT   gap             271..511
FT                   /estimated_length=241
FT   exon            512..787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0229"
FT                   /number=3
FT   gap             788..1365
FT                   /estimated_length=578
FT   exon            1366..1641
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0229"
FT                   /number=4
XX
SQ   Sequence 1641 BP; 170 A; 245 C; 282 G; 125 T; 819 other;
     gctctcactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggagggtccg gagtattggg       180
     acggggagac acggcaagtg aaggcccact cacagactca ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ngttctcaca ccgtccagag gatgtatggc       540
     tgcgacgtgg ggtcggactg gcgcttcctc cgcgggtacc accagtacgc ctacgacggc       600
     aaggattaca tcgccctgaa agaggacctg cgctcttgga ccgcggcgga catggcagct       660
     cagaccacca agcacaagtg ggaggcggcc catgtggcgg agcagttgag agcctacctg       720
     gagggcacgt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacggnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnacgcc cccaaaacgc      1380
     atatgactca ccacgctgtc tctgaccatg aagccaccct gaggtgctgg gccctgagct      1440
     tctaccctgc ggagatcaca ctgacctggc agcgggatgg ggaggaccag acccaggaca      1500
     cggagctcgt ggagaccagg cctgcagggg atggaacctt ccagaagtgg gcggctgtgg      1560
     tggtgccttc tggacaggag cagagataca cctgccatgt gcagcatgag ggtttgccca      1620
     agcccctcac cctgagatgg g                                                1641
//


spacer
spacer