Dbfetch

ID   HM370046; SV 1; linear; genomic DNA; STD; HUM; 3717 BP.
XX
AC   HM370046;
XX
DT   05-JUL-2010 (Rel. 105, Created)
DT   05-JUL-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*1532 allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3717
RA   Xu Y., Deng Z., Yang B.;
RT   "Characterization and polymorphism analyses of HLA-B genomic full length in
RT   Chinese Han population";
RL   Unpublished.
XX
RN   [2]
RP   1-3717
RA   Xu Y., Deng Z., Yang B.;
RT   ;
RL   Submitted (30-MAY-2010) to the INSDC.
RL   Immunogenetic Laboratory, Shenzhen Blood Center, 2 Meigang South Street,
RL   Nigang West Road, Shenzhen, Guangdong 518035, China
XX
DR   MD5; 786350641e37674a3a7288a67d3a2977.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3717
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /PCR_primers="fwd_seq: ccagttcarggacagggattc, rev_seq:
FT                   aacagactcagcacagcraac"
FT                   /db_xref="taxon:9606"
FT   gene            1..3717
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1532"
FT   misc_feature    1..410
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1532"
FT                   /note="contains promoter and 5' UTR"
FT   mRNA            join(<411..483,613..882,1128..1403,1979..2254,2359..2475,
FT                   2917..2949,3056..3717)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1532"
FT                   /product="MHC class I antigen"
FT   CDS             join(411..483,613..882,1128..1403,1979..2254,2359..2475,
FT                   2917..2949,3056..3099)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1532"
FT                   /product="MHC class I antigen"
FT                   /note="glycoprotein"
FT                   /db_xref="GOA:C5J405"
FT                   /db_xref="IMGT/HLA:B*15:32:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C5J405"
FT                   /protein_id="ADJ56367.1"
FT                   /translation="MRVTAPRTVLLLLSGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQRMSGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQWRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   3'UTR           3100..3717
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1532"
XX
SQ   Sequence 3717 BP; 715 A; 1049 C; 1147 G; 806 T; 0 other;
     caggaggaga agtgaagggg aagcgggtgg gcgcagcctg ggggtctctc cctggtttcc        60
     acagacagat ccttgtgcag gactcaggca gacagtgtga caaagaggct ggtgtaggag       120
     aagagggatc aggacgaagt cccaggtccc ggacggggct ctcagggtct caggctccga       180
     gagccttgtc tgcattgggg aggcgcagcg ttggggattc cccactccca cgagtttcac       240
     ttcttctccc aacctatgtc gggtccttct tccaggatac tcgtgacgcg tccccatttc       300
     ccactcccat tgggtgtcgg gtgtctagag aagccaatca gtgtcgccgg ggtcccagtt       360
     ctaaagtccc cacgcaccca cccggactca aaatctcctc agacgccgag atgcgggtca       420
     cggcgccccg aaccgtcctc ctgctgctct cgggagccct ggccctgacc gagacctggg       480
     ccggtgagtg cggggtcggc agggaaatgg cctctgtggg gaggagcgag gggaccgcag       540
     gcgggggcgc aggacccggg gagccgcgcc gggaggaggg tcgggcgggt ctcagcccct       600
     cctcgccccc aggctcccac tccatgaggt atttctacac cgccatgtcc cggcccggcc       660
     gcggggagcc ccgcttcatc gcagtgggct acgtggacga cacccagttc gtgaggttcg       720
     acagcgacgc cgcgagtccg aggatggcgc cccgggcgcc atggatagag caggaggggc       780
     cggagtattg ggaccgggag acacagatct ccaagaccaa cacacagact taccgagaga       840
     gcctgcggaa cctgcgcggc tactacaacc agagcgaggc cggtgagtga ccccggcctg       900
     gggcgcaggt cacgactccc catcccccac gtacggcccg ggtcgccccg agtctccggg       960
     tccgagatcc gcccccctga ggccgcggga cccgcccaaa ccctcgaccg gcgagagccc      1020
     caggcgcgtt tacccggttt cattttcagt tgaggccaaa atccccgcgg gttggtcggg      1080
     gcggggcggg gctcggggga cggggctgac cgcggggcct gggccagggt ctcacaccct      1140
     ccagaggatg tctggctgcg acgtggggcc ggacgggcgc ctcctccgcg ggcatgacca      1200
     gtccgcctac gacggcaagg attacatcgc cctgaacgag gacctgagct cctggaccgc      1260
     ggcggacacg gcggctcaga tcacccagcg caagtgggag gcggcccgtg aggcggagca      1320
     gtggagagcc tacctggagg gcctgtgcgt ggagtggctc cgcagatacc tggagaacgg      1380
     gaaggagacg ctgcagcgcg cgggtaccag gggcagtggg gagccttccc catctcctat      1440
     aggtcgccgg ggatggcctc ccacgagaag aggaggaaaa tgggatcagc gctagaatgt      1500
     cgccctccct tgaatggaga atggcatgag ttttcctgag tttcctctga gggccccctc      1560
     ttctctctag gacaattaag ggatgacgtc tctgaggaaa tggaggggaa gacagtccct      1620
     aggatagtga tcaggggtcc cctttgaccc ctgcagcagc cttgggaacc gtgacttttc      1680
     ctctcaggcc ttgttctctg cctcacactc agtgtgtttg gggctctgat tccagcactt      1740
     ctgagtcact ttacctccac tcagatcagg agcagaagtc cctgttcccc gctcagagac      1800
     tcgaactttc caatgaatag gagattatcc caggtgcctg cgtccaggct ggtgtctggg      1860
     ttctgtgccc cttccccacc ccaggtgtcc tgtccattct caggctggtc acatgggtgg      1920
     tcctagggtg tcccatgaga gatgcaaagc gcctgaattt tctgactctt cccatcagac      1980
     cccccaaaga cacatgtgac ccaccacccc atctctgacc atgaggccac cctgaggtgc      2040
     tgggccctgg gcttctaccc tgcggagatc acactgacct ggcagcggga tggcgaggac      2100
     caaactcagg acaccgagct tgtggagacc agaccagcag gagatagaac cttccagaag      2160
     tgggcagctg tggtggtgcc ttctggagaa gagcagagat acacatgcca tgtacagcat      2220
     gaggggctgc cgaagcccct caccctgaga tggggtaagg agggggatga ggggtcatat      2280
     ctgttctcag ggaaagcagg agcccttctg gagcccttca gcagggtcag ggcccctcat      2340
     cttcccctcc tttcccagag ccatcttccc agtccaccat ccccatcgtg ggcattgttg      2400
     ctggcctggc tgtcctagca gttgtggtca tcggagctgt ggtcgctact gtgatgtgta      2460
     ggaggaagag ctcaggtagg gaaggggtga ggggtggggt ctgggttttc ttgtcccact      2520
     gggggtttca agccccaggt agaagtgttc cctgcctcat tactgggaag cagcatccac      2580
     acaggggcta acgcagcctg ggaccctgtg tgccagcact tactcttttg tgcagcacat      2640
     gtgacaatga aggacagatg tatcgccttg atggttgtgg tgttggggtc ctgattccag      2700
     cattcatgag tcaggggaag gtccctgcta aggacagacc ttaggagggc agttggtcca      2760
     ggacccacac ttgctttcct cgtgtttcct gatcctgccc tgggtctgta gtcatacttc      2820
     tggaaattcc ttttggttcc aagacgagga ggttcctcta agatctcatg gtcctgcttc      2880
     ctcccagtcc cctcacagga cattttcttc ccacaggtgg aaaaggaggg agctactctc      2940
     aggctgcgtg taagtggtgg gggtgggagt gtggaggagc tcacccaccc cataattcct      3000
     cctgtcccac gtctcctgcg ggctctgacc aggtcctgtt tttgttctac tccagccagc      3060
     gacagtgccc agggctctga tgtgtctctc acagcttgaa aaggtgagat tcttggggtc      3120
     tagagtgggt ggggtggcgg gtctgggggt gggtggggca gtggggaaag gcctgggtaa      3180
     tggagattct ttgattggga tgtttcgcgt gtgtcgtggg ctgttcagag tgtcatcact      3240
     taccatgact aaccagaatt tgttcatgac tgttgttttc tgtagcctga gacagctgtc      3300
     ttgtgaggga ccgagatgca ggatttcttc acgcctcccc tttgtgactt caagagcctc      3360
     tggcatctct ttctgcaaag gcacctgaat gtgtctgcgt ccctgttagc ataatgtgag      3420
     gaggtggaga gacagcccac ccttgtgtcc actgtgaccc ctgttcccat gctgatctgt      3480
     gtttcctccc cagtcatctt tcttgttcca gagaggtggg gctggatgtc tccatctctg      3540
     tctcaacttt atgtgcactg agctgcaact tcttacttcc ctactgaaaa taagaatctg      3600
     aatataaatt tgttttctca aatatttgct atgagaggtt gatggattaa ttaaataagt      3660
     caattcctgg aatttgaaag agcaaataaa gacctgagaa ccttccagaa tctgcat         3717
//